KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1019410Help
Entry
SAI5S5_1019410    CDS       T03148                                 

Gene name
mqo
Definition
(GenBank) Probable malate:quinone oxidoreductase 2
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
Pathway
sauw00020  Citrate cycle (TCA cycle)
sauw00620  Pyruvate metabolism
sauw01100  Metabolic pathways
sauw01110  Biosynthesis of secondary metabolites
sauw01120  Microbial metabolism in diverse environments
sauw01130  Biosynthesis of antibiotics
sauw01200  Carbon metabolism
Module
sauw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sauw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sauw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAI5S5_1019410 (mqo)
   00620 Pyruvate metabolism
    SAI5S5_1019410 (mqo)
Enzymes [BR:sauw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SAI5S5_1019410 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase
Motif
Other DBs
NCBI-ProteinID: CCJ19714
Position
complement(2633741..2635237)
Genome map
AA seq 498 aa AA seqDB search
MAKSNSKDIVLIGAGVLSTTFGSMLKEIEPDWNIHVYERLDRPAIESSNERNNAGTGHAA
LCELNYTVLQPDGSIDIEKAKVINEEFEISKQFWGHLVKSGSIENPREFINPLPHISYVR
GKNNVKFLKDRYEAMKAFPMFDNIEYTEDIEVMKKWIPLMMKGREDNPGIMAASKIDEGT
DVNFGELTRKMAKSIEAHPNATVQFNHEVVDFEQLSNGQWEVTVKNRLTGEKFKQVTDYV
FIGAGGGAIPLLQKTGIPESKHLGGFPISGQFLACTNPQVIEQHDAKVYGKEPPGTPPMT
VPHLDTRYIDGQRTLLFGPFANVGPKFLKNGSNLDLFKSVKTYNITTLLAAAVKNLPLIK
YSFDQVIMTKEGCMNHLRTFYPEARNEDWQLYTAGKRVQVIKDTPEHGKGFIQFGTEVVN
SQDHTVIALLGESPGASTSVSVALEVLERNFPEYKTEWAPKIKKMIPSYGESLIEDEKLM
RKIRKQTSKDLELGYYEN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtctaatagtaaagacatcgttttaattggagccggtgtacttagcacaaca
tttggttcaatgttaaaagaaattgagccagactggaatatccacgtttacgaacgcttg
gatcgtcctgcaatcgaaagttcaaacgaaagaaataatgctggtacgggtcatgcagca
ttatgtgagttgaactacacagttttacaacctgatggttctatcgacatcgaaaaagcg
aaagtgattaacgaagagtttgagatttcaaaacaattctggggtcacttagtgaaaagc
ggtagcatcgagaacccaagagaatttatcaatccattaccacacatcagttatgttaga
ggtaaaaacaatgttaaattcttaaaagatcgttacgaagcgatgaaagctttccctatg
ttcgataatatcgaatatactgaagacatcgaagtaatgaaaaaatggattccattgatg
atgaaaggccgtgaagataaccctggtatcatggcggcaagtaaaattgacgaaggtaca
gatgtaaacttcggtgaattaacacgtaaaatggctaaaagcattgaagcacatccaaat
gctacagtgcaatttaaccatgaagttgttgattttgaacaattatcaaatggtcaatgg
gaagttactgttaaaaatcgcctaactggtgagaaattcaaacaagtaactgactatgta
ttcatcggtgctggcggtggagcgattccattattacaaaaaacaggtatccctgaaagt
aaacatttgggtggattccctatcagtggtcaattcttagcttgtacaaacccacaagtt
attgaacaacacgatgccaaagtttatggtaaagagccacctggtacaccaccaatgact
gtacctcatttagatacgcgttacattgatggtcaaagaacattattatttggaccattt
gctaatgttggacctaaattcttgaaaaatggttctaacttagatttattcaagtctgtt
aaaacatacaacattacaactttattagcagcagcagttaaaaacttacctttaattaaa
tactcatttgatcaagtgattatgacaaaagaaggttgtatgaaccacttacgtactttc
tatccagaagcacgtaatgaagattggcaattatacactgctggtaaacgtgtacaagtt
atcaaagatacacctgaacacggtaaaggattcatccaattcggtacagaagtggttaac
tcacaagaccacactgtaattgcattattaggtgaatcaccaggggcttcaacttcagtt
tcagttgcgttagaagtattagaacgtaacttccctgaatacaaaactgaatgggcacct
aaaatcaagaaaatgattccatcatacggtgaatcattaattgaagacgaaaaattaatg
agaaaaatccgtaaacaaacttcaaaagacttagaattaggttactacgaaaactaa

DBGET integrated database retrieval system