KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1019480Help
Entry
SAI5S5_1019480    CDS       T03148                                 

Definition
(GenBank) Putative Anaerobic ribonucleoside-triphosphate reductase-activating protein
  KO
K04068  anaerobic ribonucleoside-triphosphate reductase activating protein [EC:1.97.1.4]
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
Brite
KEGG Orthology (KO) [BR:sauw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAI5S5_1019480
Enzymes [BR:sauw01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     SAI5S5_1019480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_12 Fer4_14 zf-CCHC_4
Motif
Other DBs
NCBI-ProteinID: CCJ19721
Position
complement(2645515..2645790)
Genome map
AA seq 91 aa AA seqDB search
MDITLNLVKAFRARFGNTKTIWVWTGFLYEYLANDCTERRELLSYIDVLVDGLFIQHLFK
PDLPYKGSLNQRIIDVQQSLSHARMIEYIVS
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
ttggatattacattaaatcttgtcaaagcatttcgagcacgttttggaaatacaaagaca
atttgggtatggactggatttttatatgaatatttagcaaatgattgtacagaacgtcga
gagttattatcatacattgacgttttagtagatggtctatttatacaacacttattcaaa
cctgatttaccatataaaggttctttaaatcaacgcattatagatgtacaacaatcactc
tcgcatgcgcgtatgattgaatatatagttagttga

DBGET integrated database retrieval system