KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1019570Help
Entry
SAI5S5_1019570    CDS       T03148                                 

Definition
(GenBank) Similar to two-component response regulator
  KO
K19082  two-component system, OmpR family, response regulator protein BraR/BceR
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
Pathway
sauw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sauw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAI5S5_1019570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sauw02022]
    SAI5S5_1019570
Two-component system [BR:sauw02022]
 OmpR family
  BraS-BraR (bacitracin transport)
   SAI5S5_1019570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CCJ19730
Position
complement(2658572..2659237)
Genome map
AA seq 221 aa AA seqDB search
MKILIVEDDFVIAESLASELKKWNYGVIVVEQFDDILSIFNQHQPQLVLLDINLPTLNGF
HWCQEIRKTSNVPIIFISSRIDNMDQIMAIQMGGDDFIEKPFNLSLTIAKIQALLRRTYD
LSVANDSLTVKGCTLILDEAKVVYQEQNIQLSLTELQILKLLFQNEDKYVSRTALIEKCW
ESENFIDDNTLAVNMTRLRKKLNTIGVNDFIITKKNVGYKV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattaattgttgaagatgattttgttatagcagaaagtttagcatctgaactt
aaaaaatggaattacggtgttattgtcgttgaacaatttgatgatatactgtctatcttt
aaccaacatcaacctcagcttgtattgctagatattaatttgccaacgttaaatggtttt
cattggtgtcaagaaatccgaaaaacatctaatgtgccaattatatttattagttcccgt
attgataatatggaccaaattatggcaatacaaatggggggagatgattttatcgaaaag
ccatttaacttgtcattaacgattgccaaaattcaagcattattgagacgaacttatgac
ttgtcagtagctaatgattcattgacggttaaaggttgtacattaatattagatgaagca
aaagtcgtgtatcaagaacaaaacatacagctatctttgactgaattacaaatattaaag
ttattatttcaaaatgaagataaatatgtaagtagaactgctttaattgaaaaatgttgg
gaatcagaaaacttcatagatgataacacattagctgttaacatgacgcgcctgcgtaaa
aaattaaatactattggcgttaatgattttatcattacaaagaaaaatgtcggatataaa
gtatag

DBGET integrated database retrieval system