KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1019760Help
Entry
SAI5S5_1019760    CDS       T03148                                 

Gene name
entB2
Definition
(GenBank) Isochorismatase transposase
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: CCJ19749
Position
complement(2686369..2686935)
Genome map
AA seq 188 aa AA seqDB search
MKMSRKTALLVLDMQEGIASSVPRIKNIIKANQRAIEAARQHRIPVIFIRLVLDKHFNDV
SSSNKVFSTIKAQGYAITEADASTRILEDLAPLEDEPIISKRRFSAFTGSYLEVYLRAND
INHLVLTGVSTSGAVLSTALESVDKDYYITVLEDAVGDRSDDKHDFIIEQILSRSCDIES
VESWKSSL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgtctcgaaaaacggcgctattagttttggatatgcaagaaggtatagcgagt
agtgtacctagaataaaaaatattattaaagcgaatcagagagcaattgaagcagcaaga
caacatcgaataccagtcattttcatacgtttagtgttagataagcattttaatgatgtc
tcctcgagtaataaagtgttttcaacaattaaagctcaaggatatgcgattactgaagca
gatgcatctacacgaatacttgaagatttagcaccactagaagatgagccgattatttct
aagcgacgctttagcgcatttacaggtagttacttggaagtttatttacgtgcaaatgat
attaatcatttagtattaacgggtgtctctacgagtggagctgtattgagcacggcatta
gaaagtgtagataaagactattatattactgttttagaagatgctgttggtgatagatca
gatgataaacatgactttattattgaacaaattttatcacgctcatgtgacattgaatcc
gtagagtcatggaaaagtagtttatag

DBGET integrated database retrieval system