KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1019780Help
Entry
SAI5S5_1019780    CDS       T03148                                 

Definition
(GenBank) Putative uncharacterized protein
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCJ19751
Position
complement(2689246..2690535)
Genome map
AA seq 429 aa AA seqDB search
MEEDLTIVLNDNGFLPDDVISPYQFFADNHNTENMKPRFFNQVTVPAFWEIKGNNNSATI
NDMGRLRGKIFYQSGERPRIVSRVEWFDDQQRVRFVDYYSKNGIKFAQTVYDLNRKAILK
KYMTAEGKEVIYENFVTSDVILDWQGKSYFFPSKLAFVLFFIKQLEITEHHFVINSLALP
FSVLYNLPSKGSDVLVWQEHCNGNVPGNMQLMCKGDMKRHCNIIIPDKNEYETMLNIADA
KVQSRILQGGYLYNYRSRNRYTKEIVILTNSDQLRNIKVLVETLPDFNFHIAAITEMSDK
LMQLDQYANVHLYPSINIDRVNELYQLCDIYLDINEGNEILNAVEQAFDYELLILGYRQT
AHHAKVTLSEHLFEHNDEITMESKDQLIQMLESLKDQQQFRDALLAQKAHAHEISREQFE
QVFKQALES
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ttggaagaagatttaacaattgtactcaatgacaatggctttttaccggacgatgttata
tcaccgtatcaattttttgcagataatcataatacagaaaatatgaaaccacgatttttt
aatcaggttactgtaccagctttttgggaaattaaaggtaacaacaattcggctacaatt
aatgatatgggacgtctacgaggcaaaatattttatcaaagtggagagcgccctagaatt
gttagtcgtgtcgaatggtttgatgaccaacaacgtgtccgatttgtcgattattattct
aagaatggtattaaatttgcacaaactgtttacgatttaaatcgtaaagcgatcttgaag
aaatatatgacagcagaaggtaaagaagtgatttatgaaaattttgtaacatctgatgtc
atattggattggcaagggaagtcttactttttcccttcaaagctcgcattcgtattattt
tttatcaagcaacttgaaattacggaacatcatttcgttattaactcactagccctacca
ttttcagtgttatataatttgccatcaaaaggtagtgatgttttggtatggcaagaacac
tgtaatggtaatgtcccgggaaatatgcaattgatgtgtaaaggtgatatgaaacgacat
tgtaatattattattccagataaaaacgaatatgaaacgatgctcaatatagcagacgca
aaggttcaatctcgtattttacaaggcggatatctatataactatcgtagtcgtaataga
tatactaaagaaattgtaatattaactaactcggatcaacttcgtaacatcaaggtattg
gttgaaactttaccagattttaattttcacatcgctgctattacagagatgtctgataag
ctaatgcaacttgatcaatatgctaatgtgcacttatacccatctattaatattgacagg
gtaaatgaactataccagttatgtgatatttatcttgatatcaatgagggtaatgaaatt
ttaaatgcggtggaacaagcgtttgactatgagttgttgattttaggttatcgtcaaacc
gcacaccatgctaaagtaacattatcagagcacttatttgagcataatgatgagataaca
atggaaagtaaagaccaattaatacaaatgttagaaagtttgaaagatcaacaacagttt
cgagatgctttattagcacaaaaagcacatgcacacgaaatctcgcgtgaacaattcgag
caagtttttaaacaggcgctcgaaagctaa

DBGET integrated database retrieval system