KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1020060Help
Entry
SAI5S5_1020060    CDS       T03148                                 

Definition
(GenBank) Putative ATP phosphoribosyltransferase regulatory subunit
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His
Motif
Other DBs
NCBI-ProteinID: CCJ19779
Position
complement(2728139..2728996)
Genome map
AA seq 285 aa AA seqDB search
MILNTVLKVKGGRVNNSEQLIALKESETAFLKYFNKADYELVDFSVVEKLDWKQLNHEDL
QQMGERNFWQHEHQIYALRNDFTDQLLRYYSMYPTAATKVAYTGLIIRNNEAAVQVGLEN
YAPSLANVQQSLKLFIQFIQQQLRDNVHFVVLGHYQLLDALLDKSLQTPDILSMIEERNL
SGLVTYLSTEHPIVQILKENTQQQLNVLEHYIPNDHPALVELKIWERWLHTQGYKDIHLD
ITAQPPRSYYTGLFIQCHFAENESRVLTGGYYKGSIEGFGLGLTL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgattttaaatacagtattgaaagtaaagggtggtcgagtgaataattcagaacaatta
attgcgttaaaagaatcggaaacagcatttttaaaatattttaataaagcggattatgag
ttagttgattttagtgtggttgaaaagttggactggaaacaattgaaccatgaggatttg
cagcagatgggtgagcgaaatttttggcaacatgagcatcaaatttatgcacttcgaaat
gattttacagatcaattattgcgttattactcaatgtatccaactgcagcaacaaaagtg
gcatacacaggtttaatcattcggaataatgaagcggctgtacaagtgggtttggaaaac
tatgcaccatcattagcgaatgtacaacagagcttaaagctatttattcagtttattcaa
cagcagttgagagacaacgtgcattttgttgtattgggacattatcaattgcttgatgcc
ttactcgataaatcgttacaaacaccagacatactatcaatgattgaggaacgtaattta
tcgggactggttacatatttgtcgactgaacatccaatcgtgcaaatcttgaaagagaat
acgcaacaacaattaaatgtattggaacactatattccaaatgaccatccagcactcgtt
gaattaaaaatatgggaacgttggttacatacacaaggttacaaagacatccatttagat
attactgcgcagccacctagatcctattacacaggcttatttattcaatgtcattttgct
gaaaatgaatctcgagttttaacaggtggttattacaaaggaagcatcgaagggtttgga
ttaggattaacactttaa

DBGET integrated database retrieval system