KEGG   Staphylococcus aureus subsp. aureus ST228/16125 (MRSA): SAI5S5_1020260Help
Entry
SAI5S5_1020260    CDS       T03148                                 

Gene name
vraE
Definition
(GenBank) VraE protein
  KO
K11632  bacitracin transport system permease protein
Organism
sauw  Staphylococcus aureus subsp. aureus ST228/16125 (MRSA)
Pathway
sauw02010  ABC transporters
sauw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sauw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SAI5S5_1020260 (vraE)
  09132 Signal transduction
   02020 Two-component system
    SAI5S5_1020260 (vraE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sauw02000]
    SAI5S5_1020260 (vraE)
Transporters [BR:sauw02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Bacitracin transporter
    SAI5S5_1020260 (vraE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsX
Motif
Other DBs
NCBI-ProteinID: CCJ19799
Position
2748639..2750462
Genome map
AA seq 607 aa AA seqDB search
MYLFSLFFSIVLYFSFTTLQFTKGVNNDDSMAIIKKGALVGSIFLFIIIVIFLMYANHLF
VKRRTREFALFQLIGLTRQNILKMLALEQMIVFLITGVVGVLCGIAGAQLLLSIVSKLMS
LSINLSIHFEPMALVLTIFMLIIAYVLILFQSALFLKRRSILSMMKDSIKTDATTAKVTT
AEVISGVLGIAMIALGYYMATEMFGTFKALTMAMTSPFIILFLTVVGAYLFFRSSVSLIF
KTLKKSKNGRVSITDVVFTSSIMYRMKKNAMSLTIIAIISAVTVTVLCFAALSKSNTDQT
LTSMAPNEFNVVATQDAKQFETKLSQQQITFSKNAYETITVDNVKDQVITLENGSDSGRT
NSILSANNKVTGNNAIITNTKSLPNIINIHLNKDLVVKGTKNETFRVTQEDKGRVYPLNL
SFNSPVVEVSPEKYQQLKTQNNVHTFYGYDIKQTSQKEKAQAIAKQFGDKVITYDEMKKE
VDATNGILIFVTSFLGLAFLVAAGCIIYIKQMDETEDELSNFRILKRIGFTHTDMLKGLL
LKITFNFGLPLLIAILHAVFAAIAFMKLMGNISFMPVIVVIVVYTLIYITFALIAFVHSN
KLIKKTI
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtatttattttcattattttttagcatcgtcttatatttcagttttacaaccttacag
tttactaaaggtgtaaataatgacgactcgatggccatcattaagaaaggtgctttagtc
ggatcaatatttttatttatcattattgtcatctttttaatgtatgccaatcatttattc
gtgaaacgccgtacacgtgaatttgcgctatttcagttgattggtttaacacgacaaaac
attttgaaaatgttagcacttgaacaaatgattgtatttttaatcacaggtgttgtcggt
gtattatgtggcattgcaggtgcacaattattgctttccatagtatctaaattgatgtcg
ttatcgattaacttatcgatacatttcgaacctatggcccttgttttaactattttcatg
ctaattattgcgtatgtactgattttatttcaaagtgctttatttctaaaaagacgtagt
atcttatcaatgatgaaagattcaattaaaactgatgccacaactgctaaagtaacgact
gcagaggttatttcaggcgtattaggtattgctatgattgcactaggctattatatggcg
acagaaatgtttggaacatttaaagcactaactatggctatgacatcaccgtttatcatt
ttatttttaacggtagtaggcgcctatttattcttcagaagttccgtgtcactaattttt
aaaactttgaaaaaatctaaaaatggacgcgtatctattacagatgttgtatttacatcg
tctattatgtaccgaatgaagaaaaatgcgatgtctttaactatcattgcaattatttct
gcagttacagtaactgtattgtgtttcgcggcattatctaaatcaaatacagatcaaacc
cttacatctatggcaccaaatgaatttaacgtggtcgctactcaagatgctaaacaattt
gaaactaaactaagccaacaacaaattacattttctaaaaatgcttacgaaactattact
gtagataatgttaaagatcaggttattactttggaaaatggtagtgattcaggtcgcacg
aattcaatattaagtgcaaataacaaggtaacaggcaacaatgccatcattacaaataca
aaatcacttcctaacattattaatatccatttaaacaaagatttagtagtaaaaggaact
aagaatgaaactttccgtgttacacaagaagacaaaggtagggtttatcctttaaatcta
agcttcaactcacctgtcgtcgaagtaagtcctgaaaagtatcagcagttgaaaacacaa
aataacgttcatactttttatggatatgatattaaacaaacatcacaaaaggaaaaagct
caagcaattgcaaaacagtttggagacaaagtcatcacttatgatgaaatgaaaaaagag
gtcgatgctactaacggtattctaatatttgttacatcatttttaggattagcattttta
gtagcagctggatgtattatttatattaaacaaatggatgaaactgaggatgaactaagt
aacttcagaatattaaaacgcataggctttacgcatacagatatgcttaagggattatta
ttaaaaattactttcaacttcggtttaccattattgattgctatattacatgcagtattc
gccgcaatagcatttatgaaattgatgggtaatatttccttcatgccggttattgtagta
attgttgtatacaccctcatttacattacttttgctttaattgcttttgtacattcaaac
aaattgattaagaaaaccatttaa

DBGET integrated database retrieval system