KEGG   Staphylococcus aureus subsp. aureus ST228/18341 (MRSA): SAI6T6_1004430Help
Entry
SAI6T6_1004430    CDS       T03149                                 

Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase vraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saux  Staphylococcus aureus subsp. aureus ST228/18341 (MRSA)
Pathway
saux00071  Fatty acid degradation
saux00072  Synthesis and degradation of ketone bodies
saux00280  Valine, leucine and isoleucine degradation
saux00310  Lysine degradation
saux00362  Benzoate degradation
saux00380  Tryptophan metabolism
saux00620  Pyruvate metabolism
saux00630  Glyoxylate and dicarboxylate metabolism
saux00640  Propanoate metabolism
saux00650  Butanoate metabolism
saux00900  Terpenoid backbone biosynthesis
saux01100  Metabolic pathways
saux01110  Biosynthesis of secondary metabolites
saux01120  Microbial metabolism in diverse environments
saux01130  Biosynthesis of antibiotics
saux01200  Carbon metabolism
saux01212  Fatty acid metabolism
saux02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saux00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAI6T6_1004430
   00630 Glyoxylate and dicarboxylate metabolism
    SAI6T6_1004430
   00640 Propanoate metabolism
    SAI6T6_1004430
   00650 Butanoate metabolism
    SAI6T6_1004430
  Lipid metabolism
   00071 Fatty acid degradation
    SAI6T6_1004430
   00072 Synthesis and degradation of ketone bodies
    SAI6T6_1004430
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI6T6_1004430
   00310 Lysine degradation
    SAI6T6_1004430
   00380 Tryptophan metabolism
    SAI6T6_1004430
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAI6T6_1004430
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAI6T6_1004430
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAI6T6_1004430
Enzymes [BR:saux01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAI6T6_1004430
Exosome [BR:saux04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAI6T6_1004430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCJ20231
Position
606299..607438
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaatactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system