KEGG   Staphylococcus aureus subsp. aureus ST228/18341 (MRSA): SAI6T6_1009370Help
Entry
SAI6T6_1009370    CDS       T03149                                 

Gene name
bsaA
Definition
(GenBank) Glutathione peroxidase homolog BsaA
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
saux  Staphylococcus aureus subsp. aureus ST228/18341 (MRSA)
Pathway
saux00480  Glutathione metabolism
saux00590  Arachidonic acid metabolism
saux01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saux00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SAI6T6_1009370 (bsaA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SAI6T6_1009370 (bsaA)
Enzymes [BR:saux01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SAI6T6_1009370 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CCJ20720
Position
complement(1281984..1282460)
Genome map
AA seq 158 aa AA seqDB search
METIYDFVVETNKGVTYKLDAYKGDVMLIVNTASECGFTSQFEGLQSLYEKYKDQGFVIL
GFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNE
KIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggagacaatttatgattttgtagtagaaacaaataaaggtgttacttacaaattagat
gcatataagggtgacgttatgctaattgttaatacagctagcgaatgtggctttacttca
caatttgaaggtttgcaatcattatacgagaaatacaaagatcaagggtttgtaattcta
ggtttcccttgtaatcaatttggtggtcaagaacctggatcaggcgaagaagcagctcaa
aactgtaaattaaactatggtgttaccttccctatgcatcaaaaaatagacgtaaaaggg
gaacatcaattacctttatttagatatttgactgcggcacaacacggattctttaatgag
aaaatcaaatggaatttcactaagtttttagtggatcgcgaaggtaacgttgttaaacga
tttgcacctcaaaaaaaacctgttcaaatcgaaagagaaatagaaaaattattataa

DBGET integrated database retrieval system