KEGG   Staphylococcus aureus subsp. aureus ST228/18341 (MRSA): SAI6T6_1009420Help
Entry
SAI6T6_1009420    CDS       T03149                                 

Gene name
gLY1
Definition
(GenBank) Aromatic amino acid beta-eliminating lyase/threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
saux  Staphylococcus aureus subsp. aureus ST228/18341 (MRSA)
Pathway
saux00260  Glycine, serine and threonine metabolism
saux01100  Metabolic pathways
saux01110  Biosynthesis of secondary metabolites
saux01120  Microbial metabolism in diverse environments
saux01130  Biosynthesis of antibiotics
saux01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saux00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAI6T6_1009420 (gLY1)
Enzymes [BR:saux01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SAI6T6_1009420 (gLY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 SepSecS Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CCJ20725
Position
complement(1293012..1294067)
Genome map
AA seq 351 aa AA seqDB search
MLILVLGGNVVISFENDYLEGAHEKVLKRLVDTNLVQASGYGFDQFTAQAIEKIKDTIDC
PNATIRFLVGGTQTNQVVINSMLESYEGVISADTGHVAVHEGGAIEYSGHKVITIPSKEG
KVSASDVETYMETFKSDFKKDHMVFPGMVYISHPTEYGTLYSKSELEELCKVCKQYQLPL
FMDGARLGYGLMSDQSDMTIKDIAKYCDVFYIGGTKIGALCGEAIVFTKNNEPKQFTTRI
KHHGALLAKGRLTGIQFLELFTDNLYFNISRHAIEMANKMKDGFKNKGYRLYFDSPTNQQ
FFILSNEKIAELEQKVKFAVWEKYDDQHRVVRFATSWATTEENLNKLLELI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgctgatattagttttagggggaaatgtagtgatctcatttgaaaatgattatttagaa
ggtgctcatgaaaaagtattaaaacgattagtagatacaaatcttgtacaagcttcggga
tatggctttgatcaattcacagctcaggcaattgaaaagattaaagatacaattgattgt
ccaaatgctacaattcgttttttagtaggtggaacacaaaccaatcaggttgttattaat
tcaatgttagaaagttacgaaggggtcatttcagcagacactggtcatgttgctgtgcat
gagggtggtgcaattgaatatagtggacataaagtaattactataccctctaaggaagga
aaagttagtgcttcagatgttgaaacttacatggagacatttaaaagtgattttaaaaag
gaccatatggtattcccaggaatggtatatatttctcatcctacagaatatggcacttta
tactctaaatcagaattggaagagttatgcaaagtatgtaagcaatatcagcttccatta
tttatggatggtgcacgattagggtatggattgatgagtgatcaatcagatatgactatt
aaagacatcgctaaatattgtgatgtattttatataggtggtacgaagataggtgcatta
tgcggggaagccattgtttttacgaaaaataatgaaccgaaacaatttaccactcgaatc
aaacatcacggtgcccttttagcaaaaggacggttaacaggcatacaatttttagaatta
tttacggacaatttatattttaatataagcagacatgctatcgaaatggcaaataagatg
aaagacgggtttaaaaataaaggctatcgtctttactttgattctccaaccaatcaacaa
ttttttattttaagtaacgagaaaatagcagagttagaacaaaaagttaaatttgctgtt
tgggaaaaatacgatgatcaacatcgtgttgttagattcgcaaccagctgggcgacaacc
gaagaaaatttaaacaaactattagaattaatctaa

DBGET integrated database retrieval system