KEGG   Staphylococcus aureus subsp. aureus ST228/18341 (MRSA): SAI6T6_1010910Help
Entry
SAI6T6_1010910    CDS       T03149                                 

Definition
(GenBank) Glucose-6-phosphate=1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
saux  Staphylococcus aureus subsp. aureus ST228/18341 (MRSA)
Pathway
saux00030  Pentose phosphate pathway
saux00480  Glutathione metabolism
saux01100  Metabolic pathways
saux01110  Biosynthesis of secondary metabolites
saux01120  Microbial metabolism in diverse environments
saux01130  Biosynthesis of antibiotics
saux01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saux00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAI6T6_1010910
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SAI6T6_1010910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saux04147]
    SAI6T6_1010910
Enzymes [BR:saux01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     SAI6T6_1010910
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     SAI6T6_1010910
Exosome [BR:saux04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SAI6T6_1010910
  Exosomal proteins of colorectal cancer cells
   SAI6T6_1010910
  Exosomal proteins of bladder cancer cells
   SAI6T6_1010910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Caprin-1_dimer
Motif
Other DBs
NCBI-ProteinID: CCJ20874
Position
1521170..1522654
Genome map
AA seq 494 aa AA seqDB search
MSTKNKHIPCLITIFGATGDLSHRKLFPSIFHLYQQDNLDEHIAIIGIGRRDITNDDFRN
QVKSSIQKHVKDTNKIDAFMEHVFYHRHDVSNEESYQELLDFSNELDSQFELKGNRLFYL
AMAPQFFGVISDYLKSSGLTDTKGFKRLVIEKPFGSDLKSAEALNNQIRKSFKEEEIYRI
DHYLGKDMVQNIEVLRFANAMFEPLWNNKYISNIQVTSSEILGVEDRGGYYESSGALKDM
VQNHMLQMVALLAMEAPISLNSEDIRAEKVKVLKSLRHFQSEDVKKNFVRGQYGEGYIDG
KQVKAYRDEDRVADDSNTPTFVSGKLTIDNFRWAGVPFYIRTGKRMKSKTIQVVVEFKEV
PMNLYYETDKLLDSNLLVINIQPNEGVSLHLNAKKNTQGIETEPVQLSYSMSAQDKMNTV
DAYENLLFDCLKGDATNFTHWEELKSTWKFVDAIQDEWNMVDPEFPNYESGTNGPLESDL
LLARDGNHWWDDIQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgagtactaaaaacaaacacatcccttgtttaatcacaatctttggtgcaactggtgac
ttaagccatcgtaagttgtttccatcaatattccatctctaccaacaagacaatttagat
gaacatattgccatcatcggtattggacgtcgtgacattactaatgatgatttccgtaat
caagtaaaatcatcaattcaaaagcacgtaaaagatacaaacaaaattgacgcgtttatg
gaacatgtcttctatcatagacatgatgttagtaatgaagaaagctatcaagaattacta
gattttagtaatgaattagatagccaatttgaattaaaaggtaatcgactattctattta
gcaatggcaccacaattctttggcgttatttctgattatctaaaatcttctggtcttact
gatacaaaaggatttaaacgccttgttatcgaaaaaccattcggtagtgatttaaaatca
gccgaagcattaaacaatcaaattcgtaaatcatttaaagaagaagaaatttatcgtatt
gaccactatttaggaaaagacatggttcaaaatatcgaggtattacgttttgcgaatgcg
atgtttgaaccattatggaataacaaatatatttcaaacatccaagttacatcttctgaa
atactaggtgttgaagatcgtggtggttattatgaatcaagtggcgcgctaaaagatatg
gtgcaaaaccacatgttacaaatggttgcattattagctatggaagcacctattagttta
aacagtgaagatatccgtgctgagaaagtaaaagtacttaaatcactgcgtcatttccaa
tctgaagatgttaaaaagaactttgttcgtggtcaatatggcgaaggctatatcgatggt
aaacaagttaaagcataccgtgatgaagatcgcgttgcagatgactctaacacacctacc
tttgtttcaggtaaattaacaattgataactttagatgggctggtgtaccattctatatt
cgtactggtaaacgtatgaaatctaaaacaattcaagttgtcgttgaatttaaagaagta
ccaatgaacttatactatgaaactgataaactattagattcaaacctattagtaatcaat
atccaacctaatgaaggtgtatctttacatctaaatgctaagaaaaatacacaaggtatc
gaaactgaacctgttcaattgtcttattcaatgagcgctcaagataaaatgaatactgta
gatgcatatgaaaatctattattcgattgtcttaaaggtgatgccactaacttcacgcac
tgggaagaattaaaatcaacatggaaatttgttgatgcaattcaagatgaatggaatatg
gttgatccagaattccctaactatgaatcaggtactaatggtccattagaaagtgattta
ctacttgctcgtgatggtaaccattggtgggacgatattcaataa

DBGET integrated database retrieval system