KEGG   Staphylococcus aureus subsp. aureus ST228/18583 (MRSA): SAI8T7_1000730Help
Entry
SAI8T7_1000730    CDS       T03150                                 

Definition
(GenBank) Probable ornithine cyclodeaminase protein
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
sauy  Staphylococcus aureus subsp. aureus ST228/18583 (MRSA)
Pathway
sauy00998  Biosynthesis of secondary metabolites - other antibiotics
sauy00999  Biosynthesis of secondary metabolites - unclassified
sauy01100  Metabolic pathways
Module
sauy_M00875  Staphyloferrin B biosynthesis, L-serine => staphyloferrin B
Brite
KEGG Orthology (KO) [BR:sauy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    SAI8T7_1000730
   00999 Biosynthesis of secondary metabolites - unclassified
    SAI8T7_1000730
Enzymes [BR:sauy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     SAI8T7_1000730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH GFO_IDH_MocA Sacchrp_dh_NADP Ig_3 THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: CCJ23807
Structure
PDB: 

Position
105488..106486
Genome map
AA seq 332 aa AA seqDB search
MLYLNRSDIEQAGGNHSQVYVDALTEALTAHAHNDFVQPLKPYLRQDPENGHIADRIIAM
PSHIGGEHAISGIKWIGSKHDNPSKRNMERASGVIILNDPETNYPIAVMEASLISSMRTA
AVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFDHIKRVFVYDQFSEACARFVDR
WQQQRPEINFIATENAKEAVSNGEVVITCTVTDQPYIEYDWLQKGAFISNISIMDVHKEV
FIKADKVVVDDWSQCNREKKTINQLVLEGKFSKEALHAELGQLVTGDIPGREDDDEIILL
NPMGMAIEDISSAYFIYQQAQQQNIGTTLNLY
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatttaaatagatcagatattgaacaagcgggaggtaatcattcacaagtttat
gtggacgcattaacagaagcattaacagcccatgcgcacaatgattttgtacaaccgctt
aagccgtatttaagacaggatcctgaaaatggacacatcgcagatcgaattattgcaatg
ccaagtcatatcggtggtgaacacgcaatttcaggtattaagtggataggtagtaagcac
gacaatccatcgaaacgtaatatggagcgtgcaagtggtgtcattattttgaatgatcca
gaaacgaattatccaattgcagttatggaagcaagtttaattagtagtatgcgtactgca
gcagtttcagtgattgcagctaagcatttggctaaaaaaggatttaaagacttaacaatc
attggttgcgggctaatcggagacaagcaattacaaagtatgttagagcaattcgatcat
attaaacgcgtgtttgtttacgatcaattctctgaagcatgtgcacgctttgttgataga
tggcaacaacagcgtccggaaattaattttattgcgacagaaaatgctaaagaagcagta
tcaaatggtgaagtagtcattacatgtaccgtaacggatcaaccatacattgaatatgat
tggttacaaaagggtgcatttattagcaacatttctatcatggatgtgcataaagaagtc
tttattaaagctgacaaagtcgtagtagatgactggtcacaatgtaatcgagaaaagaaa
actattaaccaattggtgttagaaggtaaattcagcaaagaagcacttcatgctgaacta
gggcaacttgtgacaggtgacataccaggacgtgaagacgatgatgaaatcatattactt
aatccgatgggtatggctatcgaagatatttcaagtgcttattttatttatcaacaggca
caacaacaaaatattgggacaacattgaacctatattaa

DBGET integrated database retrieval system