KEGG   Staphylococcus aureus subsp. aureus ST228/18583 (MRSA): SAI8T7_1002720Help
Entry
SAI8T7_1002720    CDS       T03150                                 

Definition
(GenBank) Probable acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sauy  Staphylococcus aureus subsp. aureus ST228/18583 (MRSA)
Pathway
sauy00071  Fatty acid degradation
sauy00072  Synthesis and degradation of ketone bodies
sauy00280  Valine, leucine and isoleucine degradation
sauy00310  Lysine degradation
sauy00362  Benzoate degradation
sauy00380  Tryptophan metabolism
sauy00620  Pyruvate metabolism
sauy00630  Glyoxylate and dicarboxylate metabolism
sauy00640  Propanoate metabolism
sauy00650  Butanoate metabolism
sauy00900  Terpenoid backbone biosynthesis
sauy01100  Metabolic pathways
sauy01110  Biosynthesis of secondary metabolites
sauy01120  Microbial metabolism in diverse environments
sauy01130  Biosynthesis of antibiotics
sauy01200  Carbon metabolism
sauy01212  Fatty acid metabolism
sauy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sauy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAI8T7_1002720
   00630 Glyoxylate and dicarboxylate metabolism
    SAI8T7_1002720
   00640 Propanoate metabolism
    SAI8T7_1002720
   00650 Butanoate metabolism
    SAI8T7_1002720
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAI8T7_1002720
   00072 Synthesis and degradation of ketone bodies
    SAI8T7_1002720
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAI8T7_1002720
   00310 Lysine degradation
    SAI8T7_1002720
   00380 Tryptophan metabolism
    SAI8T7_1002720
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAI8T7_1002720
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAI8T7_1002720
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAI8T7_1002720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sauy04147]
    SAI8T7_1002720
Enzymes [BR:sauy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAI8T7_1002720
Exosome [BR:sauy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAI8T7_1002720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: CCJ24006
Position
374341..375522
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQHKAVCAQQNGEFDSEIVPVSIPQRKGEPILVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQLLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcag
tcaccaatgcttgtcaacaacagtcgcttcggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacataaagcagtatgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcttagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgcttaagaccagctttcaaaaaagacggg
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggcgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaattattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system