KEGG   Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA): SAZ172_0578Help
Entry
SAZ172_0578       CDS       T02886                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sauz  Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA)
Pathway
sauz00071  Fatty acid degradation
sauz00072  Synthesis and degradation of ketone bodies
sauz00280  Valine, leucine and isoleucine degradation
sauz00310  Lysine degradation
sauz00362  Benzoate degradation
sauz00380  Tryptophan metabolism
sauz00620  Pyruvate metabolism
sauz00630  Glyoxylate and dicarboxylate metabolism
sauz00640  Propanoate metabolism
sauz00650  Butanoate metabolism
sauz00900  Terpenoid backbone biosynthesis
sauz01100  Metabolic pathways
sauz01110  Biosynthesis of secondary metabolites
sauz01120  Microbial metabolism in diverse environments
sauz01130  Biosynthesis of antibiotics
sauz01200  Carbon metabolism
sauz01212  Fatty acid metabolism
sauz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sauz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAZ172_0578
   00630 Glyoxylate and dicarboxylate metabolism
    SAZ172_0578
   00640 Propanoate metabolism
    SAZ172_0578
   00650 Butanoate metabolism
    SAZ172_0578
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAZ172_0578
   00072 Synthesis and degradation of ketone bodies
    SAZ172_0578
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAZ172_0578
   00310 Lysine degradation
    SAZ172_0578
   00380 Tryptophan metabolism
    SAZ172_0578
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAZ172_0578
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAZ172_0578
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAZ172_0578
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sauz04147]
    SAZ172_0578
Enzymes [BR:sauz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAZ172_0578
Exosome [BR:sauz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAZ172_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGY88679
UniProt: A0A0E1AHU4
Position
659539..660678
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEEFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagagttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system