KEGG   Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA): SAZ172_1912Help
Entry
SAZ172_1912       CDS       T02886                                 

Gene name
gatA
Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A/Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sauz  Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA)
Pathway
sauz00970  Aminoacyl-tRNA biosynthesis
sauz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sauz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAZ172_1912 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sauz03029]
    SAZ172_1912 (gatA)
Enzymes [BR:sauz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SAZ172_1912 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SAZ172_1912 (gatA)
Mitochondrial biogenesis [BR:sauz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SAZ172_1912 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Calsequestrin
Motif
Other DBs
NCBI-ProteinID: AGY90012
UniProt: A0A0E1AHR5
Structure
PDB: 

Position
complement(2065708..2067165)
Genome map
AA seq 485 aa AA seqDB search
MSIRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDE
LQAKDQMDGKLFGIPMGIKDNIITNGLETTCASKMLEGFVPIYESTVMEKLHNENAVLIG
KLNMDEFAMGGSTETSYFKKTVNPFDHKAVPGGSSGGSAAAVAAGLVPFSLGSDTGGSIR
QPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGADVNDSTS
APVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLP
NTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIF
LGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFENYDVVVGPTAPTTAFNLGEEIDDPLT
MYANDLLTTPVNLAGLPGISVPCGQSNGRPIGLQFIGKPFDEKTLYRVAYQYETQYNLHD
VYEKL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcgctacgaatcggttgagaatttattaactttaataaaagacaaaaaaatc
aaaccatctgatgttgttaaagatatatatgatgcaattgaagagactgatccaacaatt
aagtcttttctagcgctggataaagaaaatgcaatcaaaaaagcgcaagaattggatgaa
ttacaagcaaaagatcaaatggatggcaaattatttggtattccaatgggtataaaagat
aacattattacaaacggattagaaacaacatgtgcaagtaaaatgttagaaggttttgtg
ccaatttacgaatctactgtaatggaaaaactacataatgaaaatgccgttttaatcggt
aaattaaatatggatgagtttgcaatgggtggttcaacagaaacatcttatttcaaaaaa
acagttaacccatttgaccataaagcagtgccaggtggttcatcaggtggatctgcagca
gcagttgcagctggcttagtaccatttagcttaggttcagacacaggtggttcaattaga
caaccggctgcatattgtggcgttgtcggtatgaaaccaacatacggtcgtgtatctcga
tttggattagttgcttttgcatcttcattagaccaaattggtccattgactcgaaatgta
aaagataatgcaatcgtattagaagctatttctggtgcagatgttaatgactctacaagt
gcaccagttgatgatgtagactttacatctgaaattggtaaagatattaaaggattaaaa
gttgcattacctaaagaatacttaggtgaaggtgtagctgatgacgtaaaagaagcagtt
caaaacgctgtagaaactttaaaatctttaggtgctgtcgttgaggaagtatcattgcca
aatactaaatttggtattccatcatattacgtgattgcatcatcagaagcttcgtcaaac
ctttctcgttttgacggaattcgttatggttatcattctaaagaagctcattcattagaa
gaattatataaaatgtcaagatctgaaggtttcggtaaagaagtaaaacgtcgtattttc
ttaggtacatttgcattaagttcaggttactatgatgcttactataaaaaatctcaaaaa
gttagaacattgattaaaaatgactttgataaagtattcgaaaattatgatgtagtagtt
ggtccaacagcgcctacaactgcgtttaatttaggtgaagaaattgatgatccattaaca
atgtatgccaatgatttattaacaacaccagtaaacttagctggattacctggtatttct
gttccttgtggacaatcaaatggccgaccaatcggtttacagttcattggtaaaccattc
gatgaaaaaacgttatatcgtgtcgcttatcaatatgaaacacaatacaatttacatgac
gtttatgaaaaattataa

DBGET integrated database retrieval system