KEGG   Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA): SAZ172_2344Help
Entry
SAZ172_2344       CDS       T02886                                 

Gene name
rplV
Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
sauz  Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA)
Pathway
sauz03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sauz00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SAZ172_2344 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sauz03011]
    SAZ172_2344 (rplV)
Ribosome [BR:sauz03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SAZ172_2344 (rplV)
  Bacteria
    SAZ172_2344 (rplV)
  Archaea
    SAZ172_2344 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Peptidase_C92
Motif
Other DBs
NCBI-ProteinID: AGY90443
UniProt: A0A0E1ANV1
Structure
PDB: 

Position
complement(2463986..2464339)
Genome map
AA seq 117 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEH
NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgctagaacaataagaatcgcacctcgtaaagtaagactagtt
cttgacttaatcagaggtaaaaatgctgctgaagctattgcaattttaaaattaacaaac
aaagcttcatcaccagtaattgaaaaagtattaatgtccgctttagctaatgctgaacat
aactatgacatgaacacagatgaattagtagttaaagaagcatatgctaacgaaggacca
acattaaaacgtttccgtccacgtgcgcaaggtcgtgcaagtgcgattaacaaacgtaca
agccacattacaatcgtcgtaagtgacggtaaagaagaagctaaagaagcttaa

DBGET integrated database retrieval system