KEGG   Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA): SAZ172_2644Help
Entry
SAZ172_2644       CDS       T02886                                 

Gene name
mvaA
Definition
(GenBank) Hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sauz  Staphylococcus aureus subsp. aureus Z172 (MRSA/VISA)
Pathway
sauz00900  Terpenoid backbone biosynthesis
sauz01110  Biosynthesis of secondary metabolites
sauz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sauz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAZ172_2644 (mvaA)
Enzymes [BR:sauz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SAZ172_2644 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red YAcAr UPF0180
Motif
Other DBs
NCBI-ProteinID: AGY90743
UniProt: A0A0E1APV0
Position
complement(2774907..2776184)
Genome map
AA seq 425 aa AA seqDB search
MQNLDKNFRHLSRKEKLQQLVDKQWLSEEQFDILLNHPLIDEEVANSLIENVIAQGALPV
GLLPNIIVDDKAYVVPMMVEEPSVVAAASYGAKLVNQTGGFKTVSSERIMIGQIVFDGVD
DTEKLSADIKALEKQIHKIADEAYPSIKARGGGYQRIAIDTFPEQQLLSLKVFVDTKDAM
GANMLNTILEAITAFLKNEFPQSDILMSILSNHATASVVKVQGEIDVKDLARGERTGEEV
AKRMERASVLAQVDIHRAATHNKGVMNGIHAVVLATGNDTRGAEASAHAYASRDGQYRGI
ATWRYDQDRQRLIGTIEVPMTLAIVGGGTKVLPIAKASLELLNVESAQELGHVVAAVGLA
QNFAACRALVSEGIQQGHMSLQYKSLAIVVGAKGDEIAKVAEALKKEPRANTQAAEHILQ
EIRQQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatttagataagaattttcgacatttatctcgtaaagaaaagttacaacaattg
gttgataagcaatggttatcagaagaacaattcgacattttactgaatcatccattaatc
gatgaagaagtagccaatagtttaattgaaaatgtcatcgcgcaaggtgcattacccgtt
ggattattaccgaatatcattgtggacgataaggcatatgttgtacctatgatggtggaa
gagccttcagttgtcgctgcagctagttatggtgcaaagctagtgaatcagactggcgga
tttaaaacggtatcttctgaacgtattatgataggtcaaatcgtctttgatggcgttgac
gatactgaaaaattatcagcagacattaaagctttagaaaagcaaattcataaaattgcg
gatgaggcatatccttctattaaagcgcgtggtggtggttaccaacgtatagcgattgat
acatttcctgagcaacagttactatctttaaaagtatttgttgatacgaaagatgctatg
ggcgctaatatgcttaatacgattttagaggccataactgcatttttaaaaaatgaattt
ccgcaaagcgacattttaatgagtattttatccaatcatgcaacagcgtccgttgttaaa
gttcaaggcgaaattgatgttaaagatttagcaaggggcgagagaactggagaagaggtt
gccaaacgaatggaacgtgcttctgtattggcccaagtagatattcatcgtgcagcaaca
cataataaaggtgttatgaatggcatacatgctgttgttttagcaacaggaaatgatacg
cgtggtgcagaagcaagtgcgcatgcatacgcgagtcgtgacggacagtatcgtggtatt
gctacatggcgttacgatcaagatcgtcaacgattgattggtacaattgaagtgcctatg
acattggcaatcgttggcggtggtacaaaagtattaccaattgctaaagcttcattagag
ctactaaatgtagagtcagcacaagaattaggtcatgtagttgctgccgttggtttagcg
caaaactttgcagcatgtcgcgcgcttgtgtcagaaggtattcaacaaggtcatatgagt
ttacaatataaatcattagctatcgttgtaggggcaaaaggtgatgaaattgctaaagta
gctgaagctttgaaaaaagaaccccgtgcaaatacacaagcagcggaacatattttacaa
gaaattagacaacaatag

DBGET integrated database retrieval system