KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV0534
Entry
SAV0534           CDS       T00052                                 
Symbol
secE
Name
(GenBank) preprotein translocase subunit
  KO
K03073  preprotein translocase subunit SecE
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav02024  Quorum sensing
sav03060  Protein export
sav03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAV0534 (secE)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAV0534 (secE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAV0534 (secE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sav02044]
    SAV0534 (secE)
Secretion system [BR:sav02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SAV0534 (secE)
SSDB
Motif
Pfam: SecE
Other DBs
NCBI-ProteinID: BAB56696
UniProt: P0A0I1
Position
599439..599621
AA seq 60 aa
MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFG
NT seq 183 nt   +upstreamnt  +downstreamnt
atggctaaaaaagaaagtttctttaaaggcgttaagtctgaaatggaaaaaacaagttgg
ccgacgaaagaagagctatttaaatatactgtaattgtagtttctactgttatattcttc
ttagtctttttctatgccttagatttaggaattacagcattgaaaaatttattatttggt
tag

DBGET integrated database retrieval system