KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV0635
Entry
SAV0635           CDS       T00052                                 

Definition
(GenBank) hypothetical protein
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Motif
Pfam: Peptidase_M50B Otopetrin Peptidase_M50
Other DBs
NCBI-ProteinID: BAB56797
UniProt: A0A0H3JQ88
Position
complement(708333..709085)
AA seq 250 aa
MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLF
NKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYLMPPIMLLIGLAS
SHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMS
YQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVN
ILLKYTHLIN
NT seq 753 nt   +upstreamnt  +downstreamnt
atgaattatttatcaaacttttttaatacgacaattcaacttaatatatacattatcgtt
attgttgcagcttgttatattgctattcatcaatatagacataagcctgttttgaactat
ttagatgtcattttaaactatatccctgttttaacacatgaatttggtcatgtactgttt
aataaactcgctggtggccgtgcaaaagatttagtcattgtaacaagtccacgagagcga
caacagacattacaacaaggattcgcaattacacaatctagacatctagcaggccaatgg
cttacaacgattggtggttatttaatgccacctattatgttattgataggtttagcgtcg
agccattatcagatacctagtttctttatatttacctatttattgatatttatttatttt
ttaattttaacatctagaaaaggctcacccattgttgttataactttaatttctatcatg
ttgtattttatattaaaagatgaaaatatagtagaaattcaactacttgtcacaatgagt
tatcaatatattttaggtgtattattaggcgaagttctacaatctagttggacgattgct
aaattgactttccagcgtccgagtccacagtgggatggtagtgcacttaaagaactcagt
catgtacctatcttcatttatagtacaatctggattatcttcaatctttatgcagtgaat
attttactcaaatatactcacttgataaattaa

DBGET integrated database retrieval system