KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV0762
Entry
SAV0762           CDS       T00052                                 
Name
(GenBank) similar to O-acetyltransferase
  KO
K24872  heptaprenylglycerol acetyltransferase [EC:2.3.1.-]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00564  Glycerophospholipid metabolism
sav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SAV0762
Enzymes [BR:sav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-
     SAV0762
SSDB
Motif
Pfam: Hexapep_2 Hexapep
Other DBs
NCBI-ProteinID: BAB56924
UniProt: Q99VL4
Position
844422..844907
AA seq 161 aa
MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVLKRHIYKQLLNINIGN
QSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRYGPVTIGSNTLIGANAT
ILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR
NT seq 486 nt   +upstreamnt  +downstreamnt
ttgagaaaatttttatcaaaaacacatcatcatacaaaccctttatggcgtgtataccgt
cttgttaaattttcgaaagtttttaagaatgtaattatcattgaattttcgaaatttatt
ccaagtatggtactgaaaagacatatatataaacaacttttaaatattaatatcggtaat
caatcatcgatagcttataaagtaatgttagatattttttacccagaactgattacgatt
ggtagtaacagtgttattggttacaatgtaacaattttgacgcatgaagcattagttgat
gaatttcgttatggaccagtgacgataggatctaacactttgattggtgcaaatgctacc
attttacccggtataacgattggtgacaatgtaaaagttgcagctggtacggttgtttca
aaagatataccggataatggatttgcatatggcaaccctatgtatataaaaatgattagg
aggtga

DBGET integrated database retrieval system