KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV1051
Entry
SAV1051           CDS       T00052                                 

Name
(GenBank) ATL autolysin transcription regulator
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
SSDB
Motif
Pfam: MarR MarR_2 HTH_27 TrmB
Other DBs
NCBI-ProteinID: BAB57213
UniProt: A0A0H3JRR6
Position
1102044..1102463
AA seq 139 aa
MYKQLEKLITLTNNDLNLVNRRFGQRTDITSEQLELLRILFNYDRLSQYDLTMKISREQS
IVSRWIKKLVLKGYITSQQSSEDLRCKELILTDQARTLISQINNARCELIEARCQCLSEV
ELDNLNQLLDKLNQRRISL
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtataaacaacttgaaaaacttattacactgactaacaatgacttaaacttagtgaat
agaagatttggacaacgcacggatatcacatctgaacagctagaacttctccgtatttta
tttaattacgatcgcttatcacagtatgatttgacgatgaagattagcagggaacaatct
atagtttcaaggtggattaagaaattagttttgaaaggttacatcacaagtcaacaatct
agcgaagatttaagatgtaaagaattaattttgactgatcaagcacgtacattaatttca
caaataaataatgcacgttgcgaattgattgaagcaagatgtcaatgtttatcggaagtc
gaattagacaatttaaatcaattacttgataagttaaatcaacgacgcatatcgttgtaa

DBGET integrated database retrieval system