KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV1568
Entry
SAV1568           CDS       T00052                                 

Gene name
cdd
Definition
(GenBank) cytidine deaminase
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00240  Pyrimidine metabolism
sav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAV1568 (cdd)
Enzymes [BR:sav01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     SAV1568 (cdd)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 dCMP_cyt_deam_2 LmjF365940-deam ADH_N DUF2685
Other DBs
NCBI-ProteinID: BAB57730
UniProt: A0A0H3JRT6
Position
complement(1680003..1680407)
AA seq 134 aa
MSYQPHYFQEVRKAQQESYSPYSQFKVGAYLKTKDGRTFYGTNVENASYPLSICAERASL
VSAISQGYRPGDFESITVTVDADKPSSPCGACRQVLKELCDDDMPVYMTNHKGDMVMMTV
AELLPFGFSGKDLE
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagttatcaacctcattattttcaagaagttagaaaagcacaacaagaatcatattcg
ccatacagtcaatttaaagtaggggcttatttaaaaacgaaagacggtagaactttttat
ggtaccaatgtagaaaatgcttcttatccattatcgatatgtgctgaacgagctagtttg
gtatcggcaatttctcaaggatacagaccaggtgattttgaatcaataactgtaaccgta
gatgcagataaaccgtcatcaccttgtggtgcatgtcgtcaagttttaaaggaattatgt
gatgatgatatgcctgtgtatatgacaaatcataaaggagatatggttatgatgacagtc
gcagagttgctaccatttggattttcaggaaaggatttagaataa

DBGET integrated database retrieval system