KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV1898
Entry
SAV1898           CDS       T00052                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07029  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00561  Glycerolipid metabolism
sav00564  Glycerophospholipid metabolism
sav01100  Metabolic pathways
sav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAV1898
   00564 Glycerophospholipid metabolism
    SAV1898
Enzymes [BR:sav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     SAV1898
SSDB
Motif
Pfam: DAGK_cat YegS_C NAD_kinase
Other DBs
NCBI-ProteinID: BAB58060
UniProt: Q99SY8
Structure
PDB: 
2QV7 2QVL

Position
complement(2038168..2039115)
AA seq 315 aa
MRKRARIIYNPTSGKELFKRELPDALIKLEKAGYETSAYATEKIGDATLEAERAMHENYD
VLIAAGGDGTLNEVVNGIAEKPNRPKLGVIPMGTVNDFGRALHIPNDIMGALDVIIEGHS
TKVDIGKMNNRYFINLAAGGQLTQVSYETPSKLKSIVGPFAYYIKGFEMLPQMKAVDLRI
EYDGNVFQGEALLFFLGLTNSMAGFEKLVPDAKLDDGYFTLIIVEKSNLAELGHIMTLAS
RGEHTKHPKVIYEKAKAINISSFTDLQLNVDGEYGGKLPANFLNLERHIDVFAPNDIVNE
ELINNDHVDDNLIEE
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaggaaacgtgctagaatcatttataacccgacatcaggtaaagagctatttaaaaga
gaattacctgatgccttaataaaattagaaaaagcgggatatgaaacgagtgcatatgca
accgagaaaataggtgatgccacacttgaagcagaaagagctatgcatgaaaattatgat
gtattaatcgctgcaggtggtgatggaacattaaatgaagtagttaatggtatcgcagaa
aagcctaatcgtcctaagctaggtgtcattcctatgggtactgttaatgactttggacgt
gcattgcatatacctaatgacatcatgggggcacttgatgtcatcattgaaggtcattct
actaaagtagatattggtaaaatgaataatcgatactttattaatttagctgcaggcgga
caattgacgcaagtctcttatgaaacaccgagtaaattgaaatctattgttggtccattt
gcttattacatcaaaggtttcgaaatgttacctcaaatgaaagctgtagatttaagaatt
gaatatgatggtaatgttttccaaggagaagcattattattctttttaggtttaacaaat
tcaatggcaggatttgaaaaattagtgccggacgctaagttagatgacggctattttacg
ttaattatagttgaaaaatcaaaccttgcagaacttggtcatattatgactttagcttca
agaggagaacatactaagcatcctaaagttatttatgaaaaagcaaaggcaattaatatt
tcatcattcacagacttacaactaaatgtagatggagaatatggtggtaaattaccagcg
aatttcttaaatctagaacgtcatatagatgtctttgcacctaatgatattgtaaatgaa
gagttaataaataatgatcatgttgatgacaatttaatcgaagaataa

DBGET integrated database retrieval system