KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV2315
Entry
SAV2315           CDS       T00052                                 

Name
(GenBank) similar to transcription regulator RpiR family
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
SSDB
Motif
Pfam: HTH_6 SIS SIS_2 DUF2529 HTH_Crp_2 FleQ Med25
Other DBs
NCBI-ProteinID: BAB58477
UniProt: A0A0H3JWX3
Position
2439986..2440858
AA seq 290 aa
MSNVLTEIDSQYPYMTKNEKKIAKFILNSPQKVIKMRSQDLASLLDISTSSVIRFSKKIT
DGGFHDLKINISKYVPKASSIYNVELMNNESTESLRTKLHTRTTRALNHANNELNDKTID
QICHCLKRSETIFIYGFGASFVVATDLYQKLSRIGLNIQLVQETHIFATLLATHNSNDSV
ILITNNGTQSEMQSMVKVIDDYHIPIITITSTRDNPVAQASNIVLTYGKTDENEMHMGAT
TSLFAQMFTIDILYYRYVALNYHASLDFITQSKMALDNYRKHLSNINFKH
NT seq 873 nt   +upstreamnt  +downstreamnt
atgtcaaacgtactaacagaaatagatagtcaatatccatatatgactaaaaatgaaaaa
aagatagctaaatttatactaaattcacctcaaaaggtgattaaaatgaggtctcaagac
ttagcaagcttattagatattagtacatcatcagtcattcgattcagcaagaaaattact
gatggcggttttcacgacttgaaaataaatatatctaaatatgttcctaaagcatcatca
atttacaatgttgaattaatgaataacgaaagcacagaatctttaagaactaaactccat
acacgtactacacgcgcacttaatcatgcaaataacgaattaaatgataaaactattgat
caaatatgtcattgtttaaaacgttctgagacgatttttatatatggttttggcgcatct
tttgtagttgctaccgacttataccaaaagttatcaagaataggtcttaatattcaactt
gttcaagaaacacatatttttgctacattattagcaactcacaattcgaacgacagtgtt
attcttattactaacaatggtacgcaaagtgaaatgcaatcaatggttaaagttattgat
gactaccatatacctataattacaattactagtacaagggataatcccgtagcacaggca
tcaaatattgttttaacttatgggaaaactgatgaaaatgagatgcatatgggagcaaca
acttcattatttgctcaaatgttcactattgatattttatattatcgttatgttgcatta
aattatcacgcatcattagatttcataacacaatctaaaatggctttagataactatcgt
aaacatttatcaaatattaactttaaacattaa

DBGET integrated database retrieval system