KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV2388
Entry
SAV2388           CDS       T00052                                 

Symbol
narK
Name
(GenBank) nitrite extrusion protein
  KO
K10850  MFS transporter, NNP family, putative nitrate transporter
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAV2388 (narK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sav02000]
    SAV2388 (narK)
Transporters [BR:sav02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    SAV2388 (narK)
SSDB
Motif
Pfam: MFS_1 OATP 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: BAB58550
UniProt: Q99RP1
Position
complement(2515310..2516479)
AA seq 389 aa
MYKTKGGFQLTLQTLSLVVGFMAWSIIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLR
VPFGYLTNIVGAKWVFFTSFIVLLFPIFFLSQAQTPGMLMASGFFLGVGGAIFSVGVTSV
PKYFPKEKVGLANGIYGMGNIGTAVSSFLAPPIAGIIGWQTTVRSYLIIIALFALIMFIF
GDTQERKIKVPLMAQMKTLSKNYKLYYLSYWYFITFGAFVAFGIFLPNYLVNHFGIDKVD
AGIRSGVFIALATFLRPIGGILGDKFNAVKVLMIDFVIMIIGAVILGISDHIALFTVGCL
TISICAGIGNGLIFKLVPSYFSNEAGSANGIVSMMGGLGGFFPPLVITYVANLTGSSHLA
FIFLAVFGCIALFTMRHLYQKEYGSLKHS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgtacaaaacaaaaggtggctttcaacttacattacaaacattaagtttagtggttggg
tttatggcttggagtataattgcgccattaatgccctttattaaacaagatgtcaatgtt
actgaaggtcaaatatcaatcattttagcgataccagttattttgggatcagtgctccgt
gtgccatttggttatttaacaaatattgttggtgctaaatgggtattctttacaagtttt
atcgtattgttattcccgatatttttcttaagccaagcacaaacgccgggtatgttaatg
gcatcaggatttttccttggcgtaggtggcgcaattttctctgttggtgttacatcagtt
cctaaatatttcccaaaagaaaaagtaggtctagcaaatggtatttatggtatggggaat
atcggtacagcagtttcttcatttttagcaccaccgatagcgggtattattggttggcaa
acaacagttagaagttacttaattattatcgctttatttgcattaattatgttcattttt
ggtgacacacaagaacgtaaaattaaagtgccattaatggcccaaatgaaaacattatct
aaaaactacaaattatattacttaagttattggtatttcattacttttggtgcttttgta
gcatttggtattttcttacctaactacttagtaaatcattttggaattgacaaagtagat
gctggtattcgttcaggtgtattcattgcgctggcaacattcttgagaccaataggtggt
atactaggtgataaatttaatgcagttaaagtactgatgattgattttgttattatgatt
atcggtgccgttattttaggtatttcagaccatatcgcattattcactgtaggctgttta
acaataagtatttgtgcaggtattggtaacggcttaatttttaaattagtaccatcctac
ttctcaaatgaagcaggatcagcaaatggtatcgtatcaatgatgggtggtttaggagga
ttcttcccaccgttggtcatcacatacgtagctaatttaacaggttcaagccatttagca
tttattttcttagcggtatttggatgcattgcattatttaccatgcgccatttatatcaa
aaagaatatggttcattgaaacacagttga

DBGET integrated database retrieval system