KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV2692
Entry
SAV2692           CDS       T00052                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K10947  PadR family transcriptional regulator, regulatory protein PadR
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:sav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sav03000]
    SAV2692
Transcription factors [BR:sav03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    SAV2692
Motif
Pfam: PadR HTH_34 TrmB DUF6429 FUR LexA_DNA_bind
Other DBs
NCBI-ProteinID: BAB58854
UniProt: A0A0H3JUM9
Position
complement(2859019..2859357)
AA seq 112 aa
MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYV
DTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQALNKGMINLFGGENDVN
NT seq 339 nt   +upstreamnt  +downstreamnt
atgtcagtgtcagatcagattatgaaaggtctcttagatggggcgatattaggtctcatt
gcccaaggcgaaacgtatggatatgaaattatgacgaaacttaagaatcaagagtttcca
gagataagtgagggtagtatttatccagttttaatgcgtttaaacaaaaaaggatacgtt
gatacgacaataaaaaaatctagtaatggcggcccgaggcggaaatactatacgattacc
gattcaggtttaaaggaactaaaagtatttaaatcaaaatggcaagctttgaataaaggg
atgattaacttgtttggaggggaaaacgatgttaactaa

DBGET integrated database retrieval system