KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV0133Help
Entry
SAV0133           CDS       T00052                                 

Gene name
sodM
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Brite
Enzymes [BR:sav01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SAV0133 (sodM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAB56295
UniProt: P66830
Structure
PDB: 

Position
148014..148613
Genome map
AA seq 199 aa AA seqDB search
MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANL
DKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGVIDDIKAQWGTLDEFKNEFANKA
TTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMT
AFWNIVNWKKVDELYQAAK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcatttaaattaccaaatttaccatatgcatatgatgcattggaaccatatatagat
caaagaacaatggagtttcatcacgacaaacatcacaatacgtacgtgacgaaattaaac
gcaacagttgaaggaacagagttagagcatcaatcactagcggatatgattgctaactta
gacaaggtaccggaagcgatgaggatgtcagtccgtaataatggcggtggtcattttaac
cattcattattctgggaaatactatcacctaattctgaagaaaaaggtggcgtaatagat
gacatcaaagcgcagtggggcactttagatgaatttaaaaatgaatttgcaaataaagca
acaacattatttggatcaggttggacttggttagttgttaatgatggaaaattagaaatt
gtgacaacgccaaaccaagataatccattaacagaaggcaaaacaccaatcttactattt
gatgtttgggagcatgcctactatctgaaatatcaaaataaacgtccagactatatgact
gcattttggaatattgttaactggaaaaaagttgatgaattataccaagcagcaaaataa

DBGET integrated database retrieval system