KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV0234Help
Entry
SAV0234           CDS       T00052                                 

Definition
(GenBank) putative acyl-CoA synthetase FadE
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00061  Fatty acid biosynthesis
sav00071  Fatty acid degradation
sav01100  Metabolic pathways
sav01212  Fatty acid metabolism
sav02024  Quorum sensing
Module
sav_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAV0234
   00071 Fatty acid degradation
    SAV0234
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAV0234
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sav01004]
    SAV0234
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sav04147]
    SAV0234
Enzymes [BR:sav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     SAV0234
Lipid biosynthesis proteins [BR:sav01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   SAV0234
Exosome [BR:sav04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   SAV0234
  Exosomal proteins of breast cancer cells
   SAV0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAB56396
UniProt: A0A0H3JPM7
Position
complement(272183..273688)
Genome map
AA seq 501 aa AA seqDB search
MNFDWIKTRSDFDDDKPAVIDHAKQTSWTYQQLNARADNMAHYLTSQGVKKGDVIGIFAP
NDIAILDLLFACFKTGAVFLPLNWRLNPKEIAAIVEDAQLKLLFYAEKHLSSLTDIDQNL
LHMDIDVAQYDEIVNPDYHQPFQATPVEPQDLAALIYTSGTTGSPKGVMFSYESFVHNGA
NLELTYKFNSNYITIVSTPMFHVLGFNDTVLPVLMSGGTLILQRYFNGEELNDMIAQYHP
TFIIMIPTMYYSTLRASNFNPENFRAMDYIIQGGSQPLPSIQAAFKQYGINIINGYGLTE
APLVLVNTPENSKRKPMSIGKAVMFVDARILDDNGEEVPTGEIGELAIKAKNVTPGYWNK
PAETAKAFHGRYLLTGDLAKMDDDGDIFIIDRKKELIITGGENVLPSEVENALAEHPLVD
RCVVVGYDHPKYGESIAAAIILREDEPHYAEILDQHMRSRLAGYKVPRMYVPVTHMPLNS
TQKPDKLAIRQMMNDKVSQTL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgattggataaaaacgcgttcagacttcgatgatgacaagcctgccgttatt
gatcacgcaaaacaaacatcttggacataccaacaactcaatgcacgcgctgataatatg
gcacattatttaacatctcaaggtgttaaaaaaggcgatgttatcggtatttttgcgcca
aatgatattgcaatattagatttattgtttgcttgttttaaaacaggtgcggttttttta
ccattgaattggcggcttaacccaaaagaaattgcagccattgtggaagatgcacaatta
aaactgctcttctatgctgaaaaacatttaagttcactcaccgatattgaccaaaactta
ttgcatatggatattgatgtggcgcaatatgatgaaatcgtaaatccagattatcaccaa
ccttttcaagcaacacctgttgaaccacaagatcttgcagcattaatttatacaagtggt
acaaccggatcacctaaaggtgtgatgttctcatatgaatcatttgttcataacggtgca
aacttagagctgacgtacaagttcaattcaaactatattacgattgtatcaacaccaatg
ttccatgttttagggtttaacgatactgtattaccagtattaatgtcaggtggcacactt
attcttcaacgttactttaacggcgaagaattgaatgacatgattgcacaatatcaccct
acatttattatcatgattccgacaatgtattatagtacgctacgtgctagtaattttaat
cctgaaaattttagagctatggattatatcatccaaggtggttcacaaccattaccaagt
atccaagcagcttttaaacaatatggcataaacattattaacggctatggtttaactgaa
gcacctcttgtacttgttaatacaccggaaaattcaaaacgtaagccaatgagtattggt
aaagcagtcatgttcgttgatgcacgtatccttgatgataacggtgaggaagtacctact
ggtgagattggcgaacttgcaattaaggctaaaaatgtcacgccaggatattggaataaa
ccagcagagactgccaaagcatttcatggtcgttatttattaactggtgacttagcgaag
atggacgacgatggcgatatatttattattgaccgcaaaaaagaattaatcataactggt
ggcgaaaatgtcttaccatctgaagtcgaaaatgctttagctgagcatccactagtagac
cggtgtgtggtcgttggctatgatcatccaaaatatggtgaatcaattgctgcagccatt
atacttcgcgaagatgaacctcattacgctgaaattttagatcaacatatgcgaagtcgt
ttagcaggttataaagtcccaagaatgtatgtaccagtgacacatatgccgttaaacagt
acgcagaaaccagataaacttgcgattcgacaaatgatgaatgacaaagtctcacaaaca
ctttaa

DBGET integrated database retrieval system