KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV0354Help
Entry
SAV0354           CDS       T00052                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase homologue
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00071  Fatty acid degradation
sav00072  Synthesis and degradation of ketone bodies
sav00280  Valine, leucine and isoleucine degradation
sav00310  Lysine degradation
sav00362  Benzoate degradation
sav00380  Tryptophan metabolism
sav00620  Pyruvate metabolism
sav00630  Glyoxylate and dicarboxylate metabolism
sav00640  Propanoate metabolism
sav00650  Butanoate metabolism
sav00900  Terpenoid backbone biosynthesis
sav01100  Metabolic pathways
sav01110  Biosynthesis of secondary metabolites
sav01120  Microbial metabolism in diverse environments
sav01130  Biosynthesis of antibiotics
sav01200  Carbon metabolism
sav01212  Fatty acid metabolism
sav02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAV0354
   00630 Glyoxylate and dicarboxylate metabolism
    SAV0354
   00640 Propanoate metabolism
    SAV0354
   00650 Butanoate metabolism
    SAV0354
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAV0354
   00072 Synthesis and degradation of ketone bodies
    SAV0354
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAV0354
   00310 Lysine degradation
    SAV0354
   00380 Tryptophan metabolism
    SAV0354
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAV0354
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAV0354
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAV0354
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sav04147]
    SAV0354
Enzymes [BR:sav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAV0354
Exosome [BR:sav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAV0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: BAB56516
UniProt: Q99WM3
Position
399073..400254
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQHKAVRAQQNGEFDSEIVPVSIPQRKGEPILVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQLLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcag
tcaccaatgcttgtcaacaacagtcgcttcggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacataaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcttagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgcttaagaccagctttcaaaaaagacggg
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggcgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaattattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system