KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV0400Help
Entry
SAV0400           CDS       T00052                                 

Definition
(GenBank) similar to lipoprotein, NLP/P60 family
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lysozyme_like NLPC_P60 SLT DUF1175 CHAP Peptidase_C92
Motif
Other DBs
NCBI-ProteinID: BAB56562
UniProt: A0A0H3JPP0
Structure
PDB: 

Position
complement(443107..444129)
Genome map
AA seq 340 aa AA seqDB search
MKLKITVICSVVFSLFFFLLLFLVIFFADDTDSGENNKDSSIPQGGVTVSPEVLAHRPLI
EKYGKEYGIEDYVSYILAIMQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSE
LLTSAEQQGVDIDSVIQSYNYGGGFLNYVRSHGKKYTYELAEQFSKEKSGGQKADYPNPI
AIPVNGGWRYNYGNQFYVQLVSQYLTDTSPTEFDDETVQVIMDEALKYEGFPYVFGGASP
TTSFDCSGLIQWVYDKAGISLPRVAQDQYDATQEISMEEAQAGDLIFFHSTYNAGTYVTH
VAIYLEGNRFYHAGDPIGYGDLSSRYWQDHLIGARRVIHN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaagctaaaaataacagtgatttgtagtgtggtcttctctctcttcttttttctctta
ttattcctagtcattttctttgcagatgatacggacagtggcgaaaacaacaaggattct
tctattccacaaggcggtgtgaccgtttcaccagaagtgttggcacaccgtccgttgatt
gaaaaatatggtaaggaatatgggattgaagactatgtttcttatatcttagccattatg
caagtggaatcgggcggtacagcagaagatgttatgcaaagttccgaatctttgggttta
ccgcccaacagtttgagtaccgaagagtccatcaaacaaggggttaaatatttcagtgaa
ttattaaccagtgcagaacaacaaggagtggatatagattctgttatccaatcttataat
tatggcggtggctttttaaattatgtgaggagtcatgggaaaaaatatacctatgaatta
gccgaacagttttctaaagagaagtcgggtggtcaaaaagcagactatcccaatcctata
gccatacctgtgaatggtggttggcgatataactatggaaatcagttttatgttcagttg
gtttcacaatacctaaccgacacttccccaacagaatttgatgatgaaaccgtgcaagtc
attatggacgaagccttgaaatacgaagggtttccctatgtctttggaggggcgtcgcct
accacctcttttgattgtagtggcttaatacaatgggtgtatgacaaagctggcatttct
ctccctcgtgtcgcccaagatcagtatgacgctacgcaagaaatctctatggaagaagcc
caagcaggcgaccttatcttctttcattcaacctataatgcaggcacatatgtgactcat
gtggcgatatatttagagggaaatcgcttttatcatgcaggcgacccaatcggttatggc
gacttaagcagtcgttattggcaagaccatctgattggggctagacgtgttattcataac
taa

DBGET integrated database retrieval system