KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV0407
Entry
SAV0407           CDS       T00052                                 
Name
(GenBank) hypothetical protein
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
SSDB
Motif
Pfam: TrbC DUF6541 Flp_Fap
Other DBs
NCBI-ProteinID: BAB56569
UniProt: A0A0H3JQB9
Position
complement(451130..451351)
AA seq 73 aa
MNFGQNLYNWFLDNAQSLVLLAIVVIGLFLGFKREFSKLIGFLIIALIAVGLVFNAAGVK
DVLLNLFNRIIGA
NT seq 222 nt   +upstreamnt  +downstreamnt
atgaattttgggcagaatttgtacaactggttcttggataatgcacagtcattggtattg
ttagcgattgttgtcattggactgtttttaggttttaaacgagaattttcaaaactcatt
ggcttcttgattattgctctaatcgccgtcggacttgtgttcaatgcagctggcgtgaaa
gatgtgttattaaacttatttaaccgaatcattggtgcttaa

DBGET integrated database retrieval system