KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV0576Help
Entry
SAV0576           CDS       T00052                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA c-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00071  Fatty acid degradation
sav00072  Synthesis and degradation of ketone bodies
sav00280  Valine, leucine and isoleucine degradation
sav00310  Lysine degradation
sav00362  Benzoate degradation
sav00380  Tryptophan metabolism
sav00620  Pyruvate metabolism
sav00630  Glyoxylate and dicarboxylate metabolism
sav00640  Propanoate metabolism
sav00650  Butanoate metabolism
sav00900  Terpenoid backbone biosynthesis
sav01100  Metabolic pathways
sav01110  Biosynthesis of secondary metabolites
sav01120  Microbial metabolism in diverse environments
sav01130  Biosynthesis of antibiotics
sav01200  Carbon metabolism
sav01212  Fatty acid metabolism
sav02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAV0576 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SAV0576 (vraB)
   00640 Propanoate metabolism
    SAV0576 (vraB)
   00650 Butanoate metabolism
    SAV0576 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAV0576 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SAV0576 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAV0576 (vraB)
   00310 Lysine degradation
    SAV0576 (vraB)
   00380 Tryptophan metabolism
    SAV0576 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAV0576 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAV0576 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAV0576 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sav04147]
    SAV0576 (vraB)
Enzymes [BR:sav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAV0576 (vraB)
Exosome [BR:sav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAV0576 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAB56738
UniProt: Q7A2W9
Position
652965..654104
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaatactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system