KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV1091Help
Entry
SAV1091           CDS       T00052                                 

Gene name
pdf1
Definition
(GenBank) formylmethionine deformylase homolog
  KO
K01462  peptide deformylase [EC:3.5.1.88]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:sav00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAV1091 (pdf1)
Enzymes [BR:sav01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.88  peptide deformylase
     SAV1091 (pdf1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pep_deformylase
Motif
Other DBs
NCBI-ProteinID: BAB57253
UniProt: P68825
Structure
PDB: 

Position
complement(1145457..1146008)
Genome map
AA seq 183 aa AA seqDB search
MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG
LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDA
VEV
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaatgaaagacatcattagagatggtcatccaactttgcgtcaaaaagcagct
gagttagaattaccattaactaaagaagaaaaagaaacattaatcgccatgagagagttt
ttagtaaatagtcaagatgaggaaatcgcgaaacgatatggtttacgttcaggcgttggt
ttggctgcacctcaaattaatatttctaaacgtatgattgctgttttaataccagatgat
ggcagtggcaaatcttatgactatatgcttgtgaacccaaaaattgtaagtcatagcgtt
caagaagcttatttaccaactggtgaaggttgccttagtgtcgatgataatgttgctggt
ctagttcaccgtcataatagaattacaattaaagccaaagacatcgaaggtaatgatata
caattacgactaaaaggatatccagcaattgttttccaacatgaaattgaccatttaaat
ggtgtaatgttctatgatcacattgacaaaaatcacccattacaaccacatacagatgct
gtagaagtttaa

DBGET integrated database retrieval system