KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV1232Help
Entry
SAV1232           CDS       T00052                                 

Gene name
hmrB
Definition
(GenBank) HmrB protein
  KO
K02078  acyl carrier protein
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00998  Biosynthesis of secondary metabolites - other antibiotics
sav01100  Metabolic pathways
sav01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAV1232 (hmrB)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    SAV1232 (hmrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding PP-binding_2 Ribosomal_L50 Ribosomal_L12_N
Motif
Other DBs
NCBI-ProteinID: BAB57394
UniProt: P0A001
Structure
PDB: 

Position
1292247..1292480
Genome map
AA seq 77 aa AA seqDB search
MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE
KINTVGDAVKFINSLEK
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaatttcgataaagtaaaagatatcatcgttgaccgtttaggtgtagacgctgat
aaagtaactgaagatgcatctttcaaagatgatttaggcgctgactcacttgatatcgct
gaattagtaatggaattagaagacgagtttggtactgaaattcctgatgaagaagctgaa
aaaatcaacactgttggtgatgctgttaaatttattaacagtcttgaaaaataa

DBGET integrated database retrieval system