KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV1315Help
Entry
SAV1315           CDS       T00052                                 

Definition
(GenBank) possible low specificity-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00260  Glycine, serine and threonine metabolism
sav01100  Metabolic pathways
sav01110  Biosynthesis of secondary metabolites
sav01120  Microbial metabolism in diverse environments
sav01130  Biosynthesis of antibiotics
sav01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAV1315
Enzymes [BR:sav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SAV1315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 SepSecS Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: BAB57477
UniProt: A0A0H3JZ93
Position
complement(1390809..1391834)
Genome map
AA seq 341 aa AA seqDB search
MISFENDYLEGAHEKVLKRLVDTNLVQASGYGFDQFTAQAIEKIKDTIDCPNATIRFLVG
GTQTNQVVINSMLESYEGVISADTGHVAVHEGGAIEYSGHKVITIPSKEGKVSASDVETY
METFKSDFKKDHMVFPGMVYISHPTEYGTLYSKSELEELCKVCKQYQLPLFMDGARLGYG
LMSDQSDMTIKDIAKYCDVFYIGGTKIGALCGEAIVFTKNNEPKQFTTRIKHHGALLAKG
RLTGIQFLELFTDNLYFNISRHAIEMANKMKDGFKNKGYRLYFDSPTNQQFFILSNEKIA
ELEQKVKFAVWEKYDDQHRVVRFATSWATTEENLNKLLELI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgatctcatttgaaaatgattatttagaaggtgctcatgaaaaagtattaaaacgatta
gtagatacaaatcttgtacaagcttcgggatatggctttgatcaattcacagctcaggca
attgaaaagattaaagatacaattgattgtccaaatgctacaattcgttttttagtaggt
ggaacacaaaccaatcaggttgttattaattcaatgttagaaagttacgaaggggtcatt
tcagcagacactggtcatgttgctgtgcatgagggtggtgcaattgaatatagtggacat
aaagtaattactataccctctaaggaaggaaaagttagtgcttcagatgttgaaacttac
atggagacatttaaaagtgattttaaaaaggaccatatggtattcccaggaatggtatat
atttctcatcctacagaatatggcactttatactctaaatcagaattggaagagttatgc
aaagtatgtaagcaatatcagcttccattatttatggatggtgcacgattagggtatgga
ttgatgagtgatcaatcagatatgactattaaagacatcgctaaatattgtgatgtattt
tatataggtggtacgaagataggtgcattatgcggggaagccattgtttttacgaaaaat
aatgaaccgaaacaatttaccactcgaatcaaacatcacggtgcccttttagcaaaagga
cggttaacaggcatacaatttttagaattatttacggacaatttatattttaatataagc
agacatgctatcgaaatggcaaataagatgaaagacgggtttaaaaataaaggctatcgt
ctttactttgattctccaaccaatcaacaattttttattttaagtaacgagaaaatagca
gagttagaacaaaaagttaaatttgctgtttgggaaaaatacgatgatcaacatcgtgtt
gttagattcgcaaccagctgggcgacaaccgaagaaaatttaaacaaactattagaatta
atctaa

DBGET integrated database retrieval system