KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV2365Help
Entry
SAV2365           CDS       T00052                                 

Definition
(GenBank) probable malate:quinone oxidoreductase 1
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00020  Citrate cycle (TCA cycle)
sav00620  Pyruvate metabolism
sav01100  Metabolic pathways
sav01110  Biosynthesis of secondary metabolites
sav01120  Microbial metabolism in diverse environments
sav01130  Biosynthesis of antibiotics
sav01200  Carbon metabolism
Module
sav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAV2365
   00620 Pyruvate metabolism
    SAV2365
Enzymes [BR:sav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SAV2365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 HI0933_like
Motif
Other DBs
NCBI-ProteinID: BAB58527
UniProt: P65421
Position
complement(2489578..2491113)
Genome map
AA seq 511 aa AA seqDB search
MSYFSNVPLFILKRGTVFVMTTQHSKTDVILIGGGIMSATLGTLLKELSPEKNIKVFEKL
AQPGEESSNVWNNAGTGHSALCELNYTKEGKDGTVDCSKAIKINEQYQISKQFWAYLVKT
GQLDNPDRFIQAVPHMSFVIGEDNVAFIKSRVATLKKSVLFEKMKLSQDEEEMKSWVPLM
IEGRKSDEPIALTYDETGTDVNFGALTAKLFENLEQRGVGIQYKQNVLDIKKQKSGAWLV
KVKDLETNETTTYESDFVFIGAGGASLPLLQKTGIKQSKHIGGFPVSGLFLRCTNQEVID
RHHAKVYGKAAVGAPPMSVPHLDTRFVDGKRSLLFGPFAGFSPKFLKTGSHMDLIKSVKP
NNIVTMLSAGIKEMSLTKYLVSQLMLSNDERMDDLRVFFPNAKNEDWEVITAGQRVQVIK
DTEDSKGNLQFGTEVITSDDGTLAALLGASPGASTAVDIMFDVLQRCYRDEFKGWEPKIK
EMVPSFGYRLTDHEDLYHKINEEVTKYLQVK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatttctcgaacgttccattattcattttaaaaagggggactgtatttgttatg
acaacacaacatagcaaaacagatgtcatcttaattggtggcggtattatgagtgcaaca
ttaggaacattacttaaagaattatcacctgagaaaaatattaaagtgtttgaaaaatta
gcacaacctggcgaagagagttcaaatgtatggaataatgccggtacagggcattcagca
ctttgcgagttgaactatacaaaagaaggtaaggatggcacagttgattgtagtaaagca
attaagataaatgagcagtaccaaatttcaaaacagttttgggcatatttagttaaaaca
ggacaattagataacccagatcgctttattcaagcggtgccacacatgagttttgtcatt
ggcgaagataatgtagcttttataaaaagtcgtgttgcaacgttaaagaaaagtgtttta
ttcgaaaaaatgaaattatcgcaagatgaagaagaaatgaaatcttgggtaccgttaatg
attgaaggtcgtaagtctgatgaaccaattgctttaacttatgatgaaactggtacagat
gttaactttggtgcgttaactgcaaagttatttgaaaatttagagcaacgtggtgtggga
attcaatataagcagaatgtattagacatcaagaaacagaaatctggggcatggctagtt
aaagttaaagatttagaaactaatgaaacgacaacatatgaatctgattttgtatttatt
ggtgctggcggtgcgagtttaccattactccaaaagactgggattaaacaatcaaaacat
attggtggtttcccagtaagtggattattcctgcgctgtacaaatcaagaagtgattgat
cgtcatcatgctaaagtgtacggaaaagcagcagtgggtgcgccaccaatgtcagtgccg
cacttagatacacgttttgtagacggcaagcgttcattgttatttggtccatttgcaggt
ttctcacctaaatttttaaaaacaggttcacatatggatttaattaaatcggttaaacca
aataatatcgtgacgatgttatctgcaggtatcaaagaaatgagtcttacgaagtattta
gtgtcacaattgatgttatctaatgatgagcgtatggatgatttaagagtctttttccca
aatgctaaaaatgaagattgggaagtgattacagcagggcaacgtgtccaagtaatcaag
gatactgaggattctaaaggtaacttacaatttggtaccgaagtcattacgtcagatgat
ggcacattagctgcattacttggtgcatcacctggtgcgtcaacagctgtagatattatg
tttgatgttttacagcgatgctatcgtgatgaattcaaagggtgggaaccaaagattaaa
gaaatggtgccgtcatttggttatcgcttaacagatcatgaggatttatatcacaaaatt
aatgaagaagtaactaagtatttacaagttaaataa

DBGET integrated database retrieval system