KEGG   Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA): SAV2606Help
Entry
SAV2606           CDS       T00052                                 

Definition
(GenBank) fructose-bisphosphate aldolase homolog
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
sav  Staphylococcus aureus subsp. aureus Mu50 (MRSA/VISA)
Pathway
sav00010  Glycolysis / Gluconeogenesis
sav00030  Pentose phosphate pathway
sav00051  Fructose and mannose metabolism
sav00680  Methane metabolism
sav01100  Metabolic pathways
sav01110  Biosynthesis of secondary metabolites
sav01120  Microbial metabolism in diverse environments
sav01130  Biosynthesis of antibiotics
sav01200  Carbon metabolism
sav01230  Biosynthesis of amino acids
Module
sav_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sav_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAV2606
   00030 Pentose phosphate pathway
    SAV2606
   00051 Fructose and mannose metabolism
    SAV2606
  09102 Energy metabolism
   00680 Methane metabolism
    SAV2606
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sav04131]
    SAV2606
   03036 Chromosome and associated proteins [BR:sav03036]
    SAV2606
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sav04147]
    SAV2606
Enzymes [BR:sav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SAV2606
Membrane trafficking [BR:sav04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAV2606
Chromosome and associated proteins [BR:sav03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    SAV2606
Exosome [BR:sav04147]
 Exosomal proteins
  Proteins found in most exosomes
   SAV2606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycolytic Clp_N GD_AH_C Hist_deacetyl
Motif
Other DBs
NCBI-ProteinID: BAB58768
UniProt: P67472
Position
2751721..2752611
Genome map
AA seq 296 aa AA seqDB search
MNKEQLEKMKNGKGFIAALDQSGGSTPKALKEYGVNEDQYSNEDEMFQLVHDMRTRVVTS
PSFSPDKILGAILFEQTMDREVEGKYTADYLADKGVVPFLKVDKGLAEEQNGVQLMKPID
NLDSLLDRANERHIFGTKMRSNILELNEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNI
NAKDKAEIEKVLKAELKKGLDSLNADQLVMLKLTIPTEPNLYKELAEHPNVVRVVVLSGG
YSREKANELLKDNDELIASFSRALASDLRADQSKEEFDKALGDAVESIYDASVNKN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagagcaattagaaaaaatgaaaaatggaaaaggctttattgccgcattagac
caaagtggtggtagtacaccaaaagcacttaaagaatatggtgtaaacgaagatcaatat
agcaatgaagacgaaatgttccaacttgttcacgatatgcgtacacgtgtggtaacttca
ccttcattctcaccagataaaattttgggtgctattcttttcgaacaaacaatggatcgc
gaagtagaaggcaaatacactgcagattacttagctgataaaggtgttgttccgttctta
aaagtagacaaaggtcttgctgaagagcaaaatggtgttcaattaatgaaaccaatcgac
aacttagacagtttattagaccgtgcaaacgaacgtcacatttttggtacaaaaatgcgt
tctaacattttagaattaaatgagcaaggtatcaaagacgttgttgaacaacaatttgaa
gttgctaaacaaattattgctaaaggtttagtgccaattatcgaaccagaagttaatatt
aatgcaaaagacaaagctgaaattgaaaaagtattaaaagctgaacttaaaaaaggttta
gatagcttaaatgctgatcaattagtaatgttgaaattaacaattcctactgaaccaaac
ttatacaaagagttagctgaacatcctaatgttgttcgtgtcgttgtattatcaggtggt
tacagcagagaaaaagcaaatgaattacttaaagataacgatgaacttatcgcaagtttc
tcacgtgcattagctagtgatttaagagctgatcaatctaaagaagaattcgataaagct
ttaggtgatgctgtagaatcaatctacgacgcatctgtaaacaaaaactaa

DBGET integrated database retrieval system