KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0165
Entry
SAHV_0165         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09790  uncharacterized protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Brite
KEGG Orthology (KO) [BR:saw00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SAHV_0165
SSDB
Motif
Pfam: DUF454 Glyoxalase_2
Other DBs
NCBI-ProteinID: BAF77048
Position
complement(184335..184718)
AA seq 127 aa
MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVE
NFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPK
SNHKIEE
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcgacttattttaatcgttattggcttaatatttacagcgcttggtattgcaggtgcc
gtattacctttactgccaacgaccccttttttactcgtagcagttttttgttttgctcga
agttcagatcggttttacaattggcttattaatcaaaaaatttataaagaatatgtagaa
aacttttatttacatcgaggctacacgctacaacagaaaattaaaattttaattagctta
tacattgtaataggtttttcaatttatatggtggatgttcttgcagtccgtgtaggatta
atcataatggttatcatacaaaccgctgtactctttacatttgtaaaaacattacccaaa
tcaaatcataaaatagaggagtga

DBGET integrated database retrieval system