KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0538
Entry
SAHV_0538         CDS       T00588                                 

Gene name
rplL
Definition
(GenBank) 50S ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw03010  Ribosome
Brite
KEGG Orthology (KO) [BR:saw00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SAHV_0538 (rplL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:saw03011]
    SAHV_0538 (rplL)
Ribosome [BR:saw03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SAHV_0538 (rplL)
  Bacteria
    SAHV_0538 (rplL)
SSDB
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N Bac_DNA_binding DUF2267 CwsA PP2C_C
Other DBs
NCBI-ProteinID: BAF77421
UniProt: A7WYW4
Position
603947..604315
AA seq 122 aa
MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
LK
NT seq 369 nt   +upstreamnt  +downstreamnt
atggctaatcatgaacaaatcattgaagcgattaaagaaatgtcagtattagaattaaac
gacttagtaaaagcaattgaagaagaatttggtgtaactgcagctgctccagtagcagta
gcaggtgcagctggtggcgctgacgctgcagcagaaaaaactgaatttgacgttgagtta
acttcagctggttcatctaaaatcaaagttgttaaagctgttaaagaagcaactggttta
ggattaaaagatgctaaagaattagtagacggagctcctaaagtaatcaaagaagcttta
cctaaagaagaagctgaaaaacttaaagaacaattagaagaagttggagctactgtagaa
ttaaaataa

DBGET integrated database retrieval system