KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_1089
Entry
SAHV_1089         CDS       T00588                                 

Name
(GenBank) conserved hypothetical protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB
Motif
Pfam: UPF0223 Tk-SP_N-pro
Other DBs
NCBI-ProteinID: BAF77972
UniProt: A7X0Z9
Position
1153625..1153900
AA seq 91 aa
MEYEYPIDLDWSNEEMISVINFFNHVEKYYESGVTAGDFMGAYKRFKEIVPAKAEEKQIF
NTFEKSSGYNSYKAVQDVKTHSEEQRVTAKK
NT seq 276 nt   +upstreamnt  +downstreamnt
atggaatatgagtatccaattgatttagactggagtaatgaagagatgatttcagtgata
aatttctttaatcatgtagagaagtattatgaatccggcgtgacggcaggcgactttatg
ggtgcatataaaagatttaaagaaattgtgcctgctaaagcagaggaaaaacaaattttt
aatactttcgaaaaaagtagtggctataatagttacaaagcagttcaagatgtaaaaact
cactctgaagaacaaagagtaacagctaaaaaataa

DBGET integrated database retrieval system