KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_1555
Entry
SAHV_1555         CDS       T00588                                 

Gene name
cdd
Definition
(GenBank) cytidine deaminase
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw00240  Pyrimidine metabolism
saw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAHV_1555 (cdd)
Enzymes [BR:saw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     SAHV_1555 (cdd)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 dCMP_cyt_deam_2 LmjF365940-deam ADH_N DUF2685
Other DBs
NCBI-ProteinID: BAF78438
Position
complement(1681403..1681807)
AA seq 134 aa
MSYQPHYFQEVRKAQQESYSPYSQFKVGAYLKTKDGRTFYGTNVENASYPLSICAERASL
VSAISQGYRPGDFESITVTVDADKPSSPCGACRQVLKELCDDDMPVYMTNHKGDMVMMTV
AELLPFGFSGKDLE
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagttatcaacctcattattttcaagaagttagaaaagcacaacaagaatcatattcg
ccatacagtcaatttaaagtaggggcttatttaaaaacgaaagacggtagaactttttat
ggtaccaatgtagaaaatgcttcttatccattatcgatatgtgctgaacgagctagtttg
gtatcggcaatttctcaaggatacagaccaggtgattttgaatcaataactgtaaccgta
gatgcagataaaccgtcatcaccttgtggtgcatgtcgtcaagttttaaaggaattatgt
gatgatgatatgcctgtgtatatgacaaatcataaaggagatatggttatgatgacagtc
gcagagttgctaccatttggattttcaggaaaggatttagaataa

DBGET integrated database retrieval system