KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_2339
Entry
SAHV_2339         CDS       T00588                                 
Symbol
tcaB
Name
(GenBank) TcaB protein
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Brite
KEGG Orthology (KO) [BR:saw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:saw02000]
    SAHV_2339 (tcaB)
Transporters [BR:saw02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    SAHV_2339 (tcaB)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_3
Other DBs
NCBI-ProteinID: BAF79222
Position
complement(2481248..2482456)
AA seq 402 aa
MNDLTHFNKRSPIFIIILGSLTAIGALSIDMFLPGLPDIRHDFQTTTSNAQLTLSMFMIG
LAFGNLFAGPISDSTGRRKPLIIAMIIFTLASLGIVFVHNIWLMVALRFLQGVTGGAAAV
ISRAIASDMYSGNELTKFMALLMLVNGIAPVVAPTIGGIILNYSVWRMVFVILTIFGFVM
VIGSLLKVPESLTVTNRESSSGLKTMFKNFKILLKTPRFVLPMLIQGMTFVILFTYISAS
PFIIQKIYGMTAIQFSWMFAGIGITLIISSQLTGYLVDFIDSQKLMRGMTMIQIIGVILV
TIVLLNHWNFWILAIGFIILIAPVTGVATLGFTIAMDESSSGRGSSSSLLGLVQFLFGGV
ASPLVGVKGEDNPIPYIIIIIATAVILIILQIYNMKVFKTNR
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgaatgatttaacgcattttaacaagcgttcaccgatatttattattattttaggatct
ttgacggccattggagcattatcgatagatatgtttttgcctggattaccagatattaga
catgattttcaaacaacgacgtctaacgcacaattaacattatcgatgtttatgattggt
ttagcgtttggtaatttgtttgctggtccaatttcagattcaactgggcgcagaaagccg
cttattatagctatgattatttttacattagcaagtttaggtattgtttttgtacataat
atttggctgatggttgcattaagatttcttcaaggagtgacaggtggcgcagcagcagtt
atttcaagagctatagcaagtgatatgtatagtggtaatgaactaactaagtttatggca
ttattgatgcttgttaatggtattgcaccagttgttgcgccaacaatagggggcataatt
ttaaattattctgtctggcgtatggtctttgtcattctgactatctttggtttcgtcatg
gtcataggttctttattaaaagtacctgaatcattaacagtgacaaatcgtgagtcaagt
agtggattaaaaacaatgtttaaaaacttcaaaatattattgaagacgccacgttttgta
ttaccaatgctcattcaaggtatgacatttgtaatattatttacttatatttctgcgtct
ccgtttattattcaaaaaatttatggcatgactgcaatacaatttagttggatgtttgca
ggaattggtattacgctcattatatcaagtcaacttactgggtaccttgttgattttata
gactcacaaaaattgatgagaggcatgacgatgattcagattatcggtgtaattttagtg
acgattgtattgcttaatcattggaacttttggattttagcgataggatttatcatttta
atagcaccagtgacaggtgttgcgacacttggttttacaatagctatggatgaaagtagt
agtggtagagggagttcatcaagtttattaggtttagtgcagtttttatttggtggtgtt
gcatcgccattagtgggggtaaaaggtgaagataatcctataccttacataattattatt
atagctacagcagttatattaattattttacagatttataatatgaaggtatttaaaaca
aatcgatga

DBGET integrated database retrieval system