KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_2372
Entry
SAHV_2372         CDS       T00588                                 

Symbol
narK
Name
(GenBank) nitrite extrusion protein
  KO
K10850  MFS transporter, NNP family, putative nitrate transporter
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAHV_2372 (narK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:saw02000]
    SAHV_2372 (narK)
Transporters [BR:saw02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    SAHV_2372 (narK)
SSDB
Motif
Pfam: MFS_1 OATP 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: BAF79255
UniProt: A7X618
Position
complement(2516948..2518117)
AA seq 389 aa
MYKTKGGFQLTLQTLSLVVGFMAWSIIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLR
VPFGYLTNIVGAKWVFFTSFIVLLFPIFFLSQAQTPGMLMASGFFLGVGGAIFSVGVTSV
PKYFPKEKVGLANGIYGMGNIGTAVSSFLAPPIAGIIGWQTTVRSYLIIIALFALIMFIF
GDTQERKIKVPLMAQMKTLSKNYKLYYLSYWYFITFGAFVAFGIFLPNYLVNHFGIDKVD
AGIRSGVFIALATFLRPIGGILGDKFNAVKVLMIDFVIMIIGAVILGISDHIALFTVGCL
TISICAGIGNGLIFKLVPSYFSNEAGSANGIVSMMGGLGGFFPPLVITYVANLTGSSHLA
FIFLAVFGCIALFTMRHLYQKEYGSLKHS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgtacaaaacaaaaggtggctttcaacttacattacaaacattaagtttagtggttggg
tttatggcttggagtataattgcgccattaatgccctttattaaacaagatgtcaatgtt
actgaaggtcaaatatcaatcattttagcgataccagttattttgggatcagtgctccgt
gtgccatttggttatttaacaaatattgttggtgctaaatgggtattctttacaagtttt
atcgtattgttattcccgatatttttcttaagccaagcacaaacgccgggtatgttaatg
gcatcaggatttttccttggcgtaggtggcgcaattttctctgttggtgttacatcagtt
cctaaatatttcccaaaagaaaaagtaggtctagcaaatggtatttatggtatggggaat
atcggtacagcagtttcttcatttttagcaccaccgatagcgggtattattggttggcaa
acaacagttagaagttacttaattattatcgctttatttgcattaattatgttcattttt
ggtgacacacaagaacgtaaaattaaagtgccattaatggcccaaatgaaaacattatct
aaaaactacaaattatattacttaagttattggtatttcattacttttggtgcttttgta
gcatttggtattttcttacctaactacttagtaaatcattttggaattgacaaagtagat
gctggtattcgttcaggtgtattcattgcgctggcaacattcttgagaccaataggtggt
atactaggtgataaatttaatgcagttaaagtactgatgattgattttgttattatgatt
atcggtgccgttattttaggtatttcagaccatatcgcattattcactgtaggctgttta
acaataagtatttgtgcaggtattggtaacggcttaatttttaaattagtaccatcctac
ttctcaaatgaagcaggatcagcaaatggtatcgtatcaatgatgggtggtttaggagga
ttcttcccaccgttggtcatcacatacgtagctaatttaacaggttcaagccatttagca
tttattttcttagcggtatttggatgcattgcattatttaccatgcgccatttatatcaa
aaagaatatggttcattgaaacacagttga

DBGET integrated database retrieval system