KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_2676
Entry
SAHV_2676         CDS       T00588                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K10947  PadR family transcriptional regulator, regulatory protein PadR
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Brite
KEGG Orthology (KO) [BR:saw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:saw03000]
    SAHV_2676
Transcription factors [BR:saw03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    SAHV_2676
Motif
Pfam: PadR HTH_34 TrmB DUF6429 FUR LexA_DNA_bind
Other DBs
NCBI-ProteinID: BAF79559
Position
complement(2860658..2860996)
AA seq 112 aa
MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYV
DTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQALNKGMINLFGGENDVN
NT seq 339 nt   +upstreamnt  +downstreamnt
atgtcagtgtcagatcagattatgaaaggtctcttagatggggcgatattaggtctcatt
gcccaaggcgaaacgtatggatatgaaattatgacgaaacttaagaatcaagagtttcca
gagataagtgagggtagtatttatccagttttaatgcgtttaaacaaaaaaggatacgtt
gatacgacaataaaaaaatctagtaatggcggcccgaggcggaaatactatacgattacc
gattcaggtttaaaggaactaaaagtatttaaatcaaaatggcaagctttgaataaaggg
atgattaacttgtttggaggggaaaacgatgttaactaa

DBGET integrated database retrieval system