KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0399
Entry
SAHV_0399         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
SSDB
Motif
Pfam: AAA_10 DUF853 Pyridox_ox_2 G10 DUF3461
Other DBs
NCBI-ProteinID: BAF77282
Position
complement(446153..448606)
AA seq 817 aa
MAYPIKYMEDNLVFNHDGEVFAYYELIPYNYSFLSSDEKIQVHDNFCQLIAQNRDGKIHA
LQLATESSIRATQEQSKKEITGRLKEIAYEKIDEQTEALISMIGDNQVDYRFFIGFKLYL
NEQEVSVKNVGKEIQKAFAEFFHGVNHKLMGDFVSMPMAEIERFSKMEQLLESKLSRRFQ
IRKLEKDDFGYIIEHLYGQTGVPFDDYDYHLPKRYEDKKVLVKKYDILKPTRCLIEENQR
YLRIEQEDTTTYVAYFTINSIVGELDFPNSEIFYYQQQQFTFPVDTSMNVEIVANKKALS
TVRNKKKELKDLDSHAWESDNETSTNVVDALESVDELESNLDQTKESMYKLSYVVRVSAK
NLDELKQRCDEVKDFYDDLSIKLVRPFGDMLGLHNEFIPSSKRYINDYIQYVTSDFLAGL
GFGATQMIGENSGIYVGYNLDTGRNIYLQPSLASQGIKGSVTNALASAFIGSLGGGKSFS
NNMLVYYSVLFGGQATIVDPKAERGEWKETLPDIAHEINIVNLTSENDNKGLLDPYVILK
LPKDSESLAIDILTFLTGISSRDSEKFPVLRKAIRSVTQSKQRGLLLVIDELRKEDTPIS
NSIADHIESFVDYDFAHLLFSDGSVTQSISLEKQLNIIQVADLVLPDSNSSFEEYTTMEL
LSVAMLIVISTFALDFIHSDRSIFKIVDLDEAWSFLQVAQGKALSMRLVRAGRAMNAGVY
FVTQNADDLLDEKMKNNIGLKFAFRSTDLVEIKKTLEFFGVDKEDENNQKRLRELENGQC
LVSDIYGRVGVMQFHPIFEELLHAFDTRPPVRNEVEE
NT seq 2454 nt   +upstreamnt  +downstreamnt
atggcatatccgattaaatatatggaagataatctcgtatttaatcatgatggcgaagta
ttcgcttattatgaattaattccctataattacagttttttaagttccgatgaaaaaatt
caagttcatgataatttctgtcaattgattgcccaaaatcgtgatggcaagattcatgct
ctgcaactagcaaccgaatcaagtattcgagccacacaggaacaatcgaaaaaagaaatc
actggacgattaaaagagatagcttacgaaaaaatagatgaacagaccgaagcgttaatt
tctatgattggtgacaatcaagtagactatcgcttttttattggttttaaactctacctc
aatgaacaggaagtatccgtaaaaaatgttgggaaagaaattcaaaaagcatttgcggaa
ttctttcatggtgtgaatcacaaattaatgggcgattttgtttctatgcctatggcggaa
atcgaacgcttttctaagatggaacagttgttagaaagtaaattatccagacgctttcag
attcgtaaattggagaaagatgattttggttatattattgaacatctttacgggcaaaca
ggtgtcccttttgatgactacgactaccatttaccgaaacgatacgaagataaaaaagtg
ttggtaaagaaatacgatattctcaaacccactcgctgtttaatcgaagaaaatcaacgc
tatttacggattgaacaggaagataccactacttatgtggcgtattttacaattaatagt
attgttggtgaattggatttccctaatagtgaaattttttattaccagcaacagcagttt
actttccccgttgataccagtatgaatgttgaaattgtcgccaataaaaaagccttatct
accgttcgcaataaaaagaaagaactgaaagatttagatagccacgcatgggaaagcgac
aacgaaaccagtactaatgtggtggacgctttagaatctgtcgatgaattagaaagtaat
ttagaccaaaccaaagaatctatgtacaaactaagctatgtggtacgggtatcagcaaag
aatttggacgagctgaaacaacgttgtgatgaagtaaaagatttttatgatgatctgtct
atcaaattagtacgaccttttggcgatatgctaggcttgcataatgaatttattccctca
agcaagcgatatatcaatgactatattcaatatgtcacgtcggattttttggctggtctt
ggtttcggtgctacacaaatgattggtgaaaattctggtatttacgtcggttacaatctc
gatacaggcagaaatatttatctccaacctagccttgcaagtcaaggaattaaaggctct
gtaacaaatgcattagcgtccgcttttattggttcattaggtggcggaaaatcattctct
aacaatatgctggtctattattcagtactctttggcggacaggcaaccattgttgaccca
aaagctgaacgtggtgaatggaaagaaaccttacctgatattgcccatgaaatcaatatt
gttaatctcacgagtgagaacgacaataaagggttacttgacccttatgtgattttaaaa
ctcccgaaagattcagaaagccttgccattgatattctcacgttcttaacaggtatttcc
agccgagatagcgagaagtttcctgtcctgcgtaaagctattcggagtgtaactcaaagc
aaacaacgagggttgttattggtgattgatgaattgcgaaaagaagatacgcccatcagc
aatagtattgctgaccatatcgaaagctttgtcgattatgattttgcccatctgttattc
agtgatggcagtgtcacccaatccattagcttggaaaaacaactcaatattattcaagtg
gcagatttggtcttacccgattccaatagctcttttgaagaatacactaccatggaatta
ttaagtgtggcaatgctgattgtcattagtacctttgctttagactttatccactctgac
cgttccatttttaaaattgttgaccttgatgaggcttggagttttttacaagtggcacaa
ggaaaagctctatctatgcgattggttcgagcaggacgtgccatgaatgcaggggtctat
ttcgttactcaaaacgcggacgatttactagatgaaaagatgaagaataatattggcttg
aaatttgcctttcgttccactgacctagtggaaatcaaaaagaccttagaattttttggt
gtggacaaggaagatgaaaacaatcagaaacgcttacgtgaattagaaaatggacaatgt
ttagtttcagacatctatggtcgtgtaggggttatgcagtttcacccgatttttgaagag
ttgcttcatgcctttgataccagaccgcctgtgcgaaatgaggtggaagaatga

DBGET integrated database retrieval system