KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0532Help
Entry
SAHV_0532         CDS       T00588                                 

Gene name
secE
Definition
(GenBank) preprotein translocase subunit
  KO
K03073  preprotein translocase subunit SecE
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw02024  Quorum sensing
saw03060  Protein export
saw03070  Bacterial secretion system
Module
saw_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:saw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAHV_0532 (secE)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAHV_0532 (secE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAHV_0532 (secE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:saw02044]
    SAHV_0532 (secE)
Secretion system [BR:saw02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   SAHV_0532 (secE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecE
Motif
Other DBs
NCBI-ProteinID: BAF77415
Position
600886..601068
Genome map
AA seq 60 aa AA seqDB search
MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFG
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaagaaagtttctttaaaggcgttaagtctgaaatggaaaaaacaagttgg
ccgacgaaagaagagctatttaaatatactgtaattgtagtttctactgttatattcttc
ttagtctttttctatgccttagatttaggaattacagcattgaaaaatttattatttggt
tag

DBGET integrated database retrieval system