KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0535Help
Entry
SAHV_0535         CDS       T00588                                 

Gene name
rplK
Definition
(GenBank) 50S ribosomal protein L11
  KO
K02867  large subunit ribosomal protein L11
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw03010  Ribosome
Module
saw_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:saw00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SAHV_0535 (rplK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:saw03011]
    SAHV_0535 (rplK)
Ribosome [BR:saw03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    SAHV_0535 (rplK)
  Bacteria
    SAHV_0535 (rplK)
  Archaea
    SAHV_0535 (rplK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11
Motif
Other DBs
NCBI-ProteinID: BAF77418
UniProt: A7WYW0
Position
601810..602232
Genome map
AA seq 140 aa AA seqDB search
MAKKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTQDQAGLIIPVEISV
YEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKTKVATVTKDQVREIANSKMQDLNAAD
EEAAMRIIEGTARSMGIVVE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaaaaagtagataaagttgttaaattacaaattcctgcaggtaaagcgaatcca
gcaccaccagttggtccagcattaggtcaagcaggtgtgaacatcatgggattctgtaaa
gagttcaatgcacgtactcaagatcaagcaggtttaattattccggtagaaatcagtgtt
tatgaagatcgttcatttacatttattacaaaaactccaccggctccagtattacttaaa
aaagcagctggtattgaaaaaggttcaggcgaaccaaacaaaactaaagttgctacagta
actaaagatcaagtacgcgaaattgctaacagcaaaatgcaagacttaaacgctgctgac
gaagaagcagctatgcgtattatcgaaggtactgcacgtagtatgggtatcgttgtagaa
taa

DBGET integrated database retrieval system