KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0536Help
Entry
SAHV_0536         CDS       T00588                                 

Gene name
rplA
Definition
(GenBank) 50S ribosomal protein L1
  KO
K02863  large subunit ribosomal protein L1
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw03010  Ribosome
Module
saw_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:saw00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SAHV_0536 (rplA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:saw03011]
    SAHV_0536 (rplA)
Ribosome [BR:saw03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    SAHV_0536 (rplA)
  Bacteria
    SAHV_0536 (rplA)
  Archaea
    SAHV_0536 (rplA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L1 DUF3599
Motif
Other DBs
NCBI-ProteinID: BAF77419
UniProt: A7WYW1
Position
602440..603132
Genome map
AA seq 230 aa AA seqDB search
MAKKGKKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVAFRLGIDTRKNDQQIR
GAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGADYVGEAEYVQKIQQGWFDFDVVVATPDM
MGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEYRAEKAGIVHASIGKVSF
TDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGVKIDTASFK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaggtaaaaagtatcaagaagcagctagtaaagttgaccgtactcagcac
tacagtgttgaagaagcaattaaattagctaaagaaacaagcattgctaactttgacgct
tctgttgaagttgcattccgtttaggaattgatacacgtaaaaatgaccaacaaatccgt
ggtgcagttgtattaccaaacggaactggtaaatcacaaagtgtattagtattcgctaaa
ggtgacaaaattgctgaagctgaagcagcaggtgctgactatgtaggtgaagcagaatac
gttcaaaaaatccaacaaggttggttcgacttcgatgtagtagttgctacaccagacatg
atgggtgaagttggtaaattaggtcgtgtattaggaccaaaaggtttaatgccaaaccct
aaaactggaactgtaacaatggatgttaaaaaagctgttgaagaaatcaaagctggtaaa
gtagaatatcgtgctgaaaaagctggtatcgtacatgcatcaattggtaaagtttcattt
actgatgaacaattaattgaaaacttcaatactttacaagatgtattagctaaagctaaa
ccatcatctgctaaaggtacatacttcaaatctgttgctgtaactacaacaatgggtcct
ggagttaaaattgatactgcaagtttcaaataa

DBGET integrated database retrieval system