KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0542Help
Entry
SAHV_0542         CDS       T00588                                 

Definition
(GenBank) hypothetical protein
  KO
K07590  large subunit ribosomal protein L7A
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Pathway
saw03010  Ribosome
Module
saw_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:saw00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SAHV_0542
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:saw03011]
    SAHV_0542
Ribosome [BR:saw03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    SAHV_0542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L7Ae eRF1_3 Cas_Cas1 DUF1694
Motif
Other DBs
NCBI-ProteinID: BAF77425
UniProt: A7WYX0
Position
612761..613015
Genome map
AA seq 84 aa AA seqDB search
MSKEKVARFNKQHFVVGLKETLKALKKDQVTSLIIAEDVEVYLMTRVLSQINQKNIPVSF
FKSKHALGKHVGINVNATIVALIK
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
ttgtctaaggaaaaagttgcacgctttaacaaacaacattttgtagttggtcttaaagaa
acgcttaaagcgttaaagaaagatcaagttacatctttgattattgctgaagacgttgaa
gtatatttaatgactcgcgtgttaagccaaatcaatcagaaaaatatacctgtatctttt
ttcaaaagcaaacatgctttgggtaaacatgtaggtattaacgtcaatgcgacaatagta
gcattgattaaatga

DBGET integrated database retrieval system