KEGG   Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA): SAHV_0545Help
Entry
SAHV_0545         CDS       T00588                                 

Gene name
fus
Definition
(GenBank) translational elongation factor G
  KO
K02355  elongation factor G
Organism
saw  Staphylococcus aureus subsp. aureus Mu3 (MRSA/hetero-VISA)
Brite
KEGG Orthology (KO) [BR:saw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:saw03012]
    SAHV_0545 (fus)
   03029 Mitochondrial biogenesis [BR:saw03029]
    SAHV_0545 (fus)
Translation factors [BR:saw03012]
 Eukaryotic Type
  Elongation factors
   SAHV_0545 (fus)
 Prokaryotic Type
   SAHV_0545 (fus)
Mitochondrial biogenesis [BR:saw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SAHV_0545 (fus)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    SAHV_0545 (fus)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU EFG_IV EFG_II EFG_C GTP_EFTU_D2 RF3_C MMR_HSR1 AIG1
Motif
Other DBs
NCBI-ProteinID: BAF77428
UniProt: A7WYX4
Structure
PDB: 

Position
614185..616266
Genome map
AA seq 693 aa AA seqDB search
MAREFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHEGASQMDWMEQEQDRG
ITITSAATTAAWEGHRVNIIDTPGHVDFTVEVERSLRVLDGAVTVLDAQSGVEPQTETVW
RQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQLPIGAEDEFEAIIDLVE
MKCFKYTNDLGTEIEEIEIPEDHLDRAEEARASLIEAVAETSDELMEKYLGDEEISVSEL
KEAIRQATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSPLDVKPIIGHRASNPEEEVI
AKADDSAEFAALAFKVMTDPYVGKLTFFRVYSGTMTSGSYVKNSTKGKRERVGRLLQMHA
NSRQEIDTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQ
DKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHLDILVDRMKKEFNVECNVGAPMV
SYRETFKSSAQVQGKFSRQSGGRGQYGDVHIEFTPNETGAGFEFENAIVGGVVPREYIPS
VEAGLKDAMENGVLAGYPLIDVKAKLYDGSYHDVDSSEMAFKIAASLALKEAAKKCDPVI
LEPMMKVTIEMPEEYMGDIMGDVTSRRGRVDGMEPRGNAQVVNAYVPLSEMFGYATSLRS
NTQGRGTYTMYFDHYAEVPKSIAEDIIKKNKGE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggctagagaattttcattagaaaaaactcgtaatatcggtatcatggctcacattgat
gctggtaaaacgactacgactgaacgtattctttattacactggccgtatccacaaaatt
ggtgaaacacacgaaggtgcttcacaaatggactggatggagcaagaacaagaccgtggt
attactatcacatctgctgcaacaacagcagcttgggaaggtcaccgtgtaaacattatc
gatacacctggacacgtagacttcactgtagaagttgaacgttcattacgtgtacttgac
ggagcagttacagtacttgatgcacaatcaggtgttgaaccacaaactgaaacagtttgg
cgtcaggctacaacttatggtgttccacgtatcgtatttgtaaacaaaatggacaaatta
ggtgctaacttcgaatactctgtaagtacattacatgatcgtttacaagctaacgctgct
ccaatccaattaccaattggtgcggaagacgaattcgaagcaatcattgacttagttgaa
atgaaatgtttcaaatatacaaatgatttaggtactgaaattgaagaaattgaaattcct
gaagaccacttagatagagctgaagaagctcgtgctagcttaatcgaagcagttgcagaa
actagcgacgaattaatggaaaaatatcttggtgacgaagaaatttcagtttctgaatta
aaagaagctatccgccaagctactactaacgtagaattctacccagtactttgtggtaca
gctttcaaaaacaaaggtgttcaattaatgcttgacgctgtaattgattacttaccttca
ccactagacgttaaaccaattattggtcaccgtgctagcaaccctgaagaagaagtaatc
gcgaaagcagacgattcagctgaattcgctgcattagcgttcaaagttatgactgaccct
tatgttggtaaattaacattcttccgtgtgtattcaggtacaatgacatctggttcatac
gttaagaactctactaaaggtaaacgtgaacgtgtaggtcgtttattacaaatgcacgct
aactcacgtcaagaaatcgatactgtatactctggagatatcgcggctgcggtaggtctt
aaagatacaggtactggtgatactttatgtggtgagaaaaatgacattatcttggaatca
atggaattcccagagccagttattcacttatcagtagagccaaaatctaaagctgaccaa
gataaaatgactcaagctttagttaaattacaagaagaagacccaacattccatgcacac
actgacgaagaaactggacaagttatcatcggtggtatgggtgagcttcacttagacatc
ttagtagaccgtatgaagaaagaattcaacgttgaatgtaacgtaggtgctccaatggtt
tcatatcgtgaaacattcaaatcatctgcacaagttcaaggtaaattctctcgtcaatct
ggtggtcgtggtcaatacggtgatgttcacattgaattcacaccaaacgaaacaggcgca
ggtttcgaattcgaaaacgctatcgttggtggtgtagttcctcgtgaatacattccatca
gtagaagctggtcttaaagatgctatggaaaatggtgtcttagcaggttatcctttaatt
gatgttaaagctaaattatatgatggttcataccatgatgtcgattcatctgaaatggcc
ttcaaaattgctgcatcattagcacttaaagaagctgctaaaaaatgtgatcctgtaatc
ttagaaccaatgatgaaagtaactattgaaatgcctgaagagtacatgggtgatatcatg
ggtgacgtaacatctcgtcgtggacgtgttgatggtatggaacctcgtggtaatgcacaa
gttgttaatgcttatgtaccactttcagaaatgttcggttatgcaacatcattacgttca
aacactcaaggtcgcggtacttacactatgtacttcgatcactatgctgaagttccaaaa
tcaatcgctgaagatattatcaagaaaaataaaggtgaataa

DBGET integrated database retrieval system